(data stored in ACNUC7421 zone)

EMBL: CP001720.PE379

CP001720.PE379       Location/Qualifiers
FT   CDS_pept        complement(410970..412409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0401"
FT                   /product="signal transduction histidine kinase regulating
FT                   citrate/malate metabolism"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; KEGG:
FT                   ent:Ent638_3378 signal transduction histidine kinase
FT                   regulating citrate/malate metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61344"
FT                   /db_xref="GOA:C8W4Z2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR039506"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4Z2"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACV61344.1"
FT                   /translation="MQLSVQDIVPIQLPILLGFKIILLGNYAGMEEANQYFMSINELII
FT                   TLILISIPQSLVVNILAAQLLGIYKKEIIKQLILVGLIDGLISFTVYMLRLPYGLHMVV
FT                   NLFLFIFVAQLLLGIHMNQAVYLTITAYAAALIFESGVVAVMLFITGLSLDELIDNFNL
FT                   RLTFTCTGIMLAGGAVYWLISRNIRIAGIEKVADFTKSYGHSIFIAFIQIALLGVVFIY
FT                   SRLQSPSYFNLIKAEVFWGIAGGLFLILNIWLILSLTAAVQRETILLANEAYMKNIEEL
FT                   FLNYRSQRHDLSNHFQTLNSLLKANKIEKALDYLKDLNKETVATNMVLKFGNPVLVALL
FT                   QVKIAKAEQKSILLDLFIGDELTHIALQSFELVKLVGNLLDNALEAAENSTIKQKKVSF
FT                   ETKNYNRLKVICIRNYGIYIDPDIMEKIFEPGFSTKDGHSGIGLSICRSLVEKYRGNIE
FT                   VYNVEEGTMVEVTVASTVKKS"
     gtgcagttat cagtgcagga tatcgtacct attcaactac ctatcctttt agggttcaaa        60
     attatccttt tgggaaatta tgcaggaatg gaggaggcga accagtattt tatgtcaata       120
     aatgaattaa tcataacatt gatactcatt tctattcctc aaagccttgt tgttaacatt       180
     ttggcagctc aactcttagg tatatataaa aaggagatca ttaaacaact cattctagtt       240
     gggttgatcg acggtttaat ctcatttacg gtttacatgc tcagacttcc ctatggccta       300
     cacatggtag ttaatttatt cctatttatt tttgttgctc aattgttgct tggaattcat       360
     atgaatcaag ctgtttattt aacgattaca gcttatgcgg ctgctctaat ctttgaaagt       420
     ggtgtcgtag ctgtgatgct tttcattacg ggtctatcac tggatgaatt gatagataat       480
     tttaatttgc ggctgacatt tacctgtaca ggaattatgt tggcaggagg ggctgtctac       540
     tggctgatta gtagaaatat acgcatagct ggtattgaaa aagtagctga ttttactaaa       600
     agctatggtc atagcatatt tatagctttt attcaaattg ctttattagg agttgtgttt       660
     atatattctc gccttcaatc tccatcttat tttaatttaa ttaaagcaga ggtgttttgg       720
     ggaatcgcag gagggttatt tttaattctt aatatttggt taattctttc acttacggct       780
     gctgttcaaa gagaaacaat tcttttagcc aatgaggctt atatgaagaa tattgaagag       840
     ctttttttga attatcgatc tcaacgtcat gacctttcca atcattttca aactctgaat       900
     tccttactga aagcaaacaa aattgaaaag gctttagatt atctaaagga cttaaataaa       960
     gaaaccgtag ccaccaatat ggtgttaaaa tttggcaatc cggttctggt cgcgctgctt      1020
     caggtaaaaa ttgctaaagc agaacaaaag agtattctct tagacctatt cattggagat      1080
     gaacttacgc atattgccct tcaatcattt gaactagtta aattagtagg taacttgctg      1140
     gacaatgcct tggaagcagc cgaaaattca acaattaaac aaaaaaaggt aagttttgag      1200
     accaagaact acaatagact aaaagttatt tgcattcgta attatggaat ttatatagac      1260
     ccagacataa tggaaaaaat atttgaaccc ggtttttcga caaaagatgg acattcggga      1320
     attgggctat ccatttgtcg atcacttgtt gaaaagtata ggggaaatat agaagtttac      1380
     aatgtggagg agggtacaat ggttgaagta acagtagcga gtacagtgaa gaagtcatga      1440
//

If you have problems or comments...

PBIL Back to PBIL home page