(data stored in ACNUC7421 zone)

EMBL: CP001720.PE38

CP001720.PE38        Location/Qualifiers
FT   CDS_pept        39354..40082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0039"
FT                   /product="spore cortex-lytic enzyme"
FT                   /note="TIGRFAM: spore cortex-lytic enzyme; PFAM: cell wall
FT                   hydrolase SleB; Peptidoglycan- binding domain 1 protein;
FT                   KEGG: bar:GBAA2748 spore cortex-lytic enzyme prepeptide"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61003"
FT                   /db_xref="GOA:C8VVD2"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR011105"
FT                   /db_xref="InterPro:IPR014224"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="InterPro:IPR042047"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVD2"
FT                   /inference="protein motif:TFAM:TIGR02869"
FT                   /protein_id="ACV61003.1"
FT                   /translation="MEINLSLRKIILIPIALFILTAFCSVIMPVAEAAAQDAPLLHWGS
FT                   SGYRVTKIQQRLNWWGYYEGPVDGLFGTKTSKAVRKFQGYNGLSKDGVVGRQTLTALGL
FT                   QEFNRTANATTTTVSRSSAYSNDGRVGLLAKVIEGEAADEPFVGKVAVGAVMLNRTRSS
FT                   AFPQSLSSVIYQPNAFESVTNGMYNRTTSEESIKAARLALNGWDPTGGALFFWNPAKRV
FT                   SSWIWSRPIITQIGGHVFAR"
     atggaaatta atttgtcact aagaaaaata atccttatac ctattgcact ttttattctg        60
     actgcttttt gttctgtaat aatgccggtt gctgaggcag cagctcagga tgctccgctt       120
     ttgcactggg gctcatctgg ttaccgggta acaaaaattc agcagaggtt aaactggtgg       180
     ggatattatg aaggtccggt tgatgggtta tttggtacta aaacctcaaa agccgtacgt       240
     aaattccagg ggtataacgg attgagcaag gatggtgtgg ttggcaggca aaccctgacg       300
     gccctgggct tgcaggaatt taaccgtact gcaaatgcaa caacaacaac cgtttccaga       360
     tccagcgctt attctaacga cggtagggtt gggcttctgg ctaaagttat tgaaggtgaa       420
     gcggcggatg agccgtttgt cggcaaggta gccgtgggtg cggttatgct taacaggact       480
     agaagctcag cttttcctca atcactaagc agtgttattt accagcctaa tgcctttgaa       540
     tccgtaacta acgggatgta caacaggacg acaagtgagg agtctattaa agctgccagg       600
     ctggctttaa acggttggga tcccacgggt ggagcattgt ttttctggaa cccggccaaa       660
     agagtaagtt cttggatatg gtccaggcca attataaccc agatcggtgg acatgtgttt       720
     gcacgttaa                                                               729
//

If you have problems or comments...

PBIL Back to PBIL home page