(data stored in ACNUC7421 zone)

EMBL: CP001720.PE383

CP001720.PE383       Location/Qualifiers
FT   CDS_pept        complement(417458..418192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0405"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61348"
FT                   /db_xref="InterPro:IPR009839"
FT                   /db_xref="InterPro:IPR027945"
FT                   /db_xref="UniProtKB/TrEMBL:C8W4Z6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61348.1"
FT                   /translation="MEEWIQKHDSGLDLTTSMERLRDNPSVEGKLRFFAELKAARLLVP
FT                   CHGENGSIAALNTPEKEVFLPAFCSADELQKWTFPLEKVSVLPLDALKHIVIDNPAQLA
FT                   GVVINPFGKALLLRHPQLAEIDSGTEGMTLARTDHQGKLDIRATTDFPVGLPKALAQLL
FT                   ATRPEVYRAWILLAREEKETRYHKLFLIDFDGDRRLLFPLVAKAVQPYMKPGESFELMK
FT                   ADFGLLQRALAVSEPVYQKKKA"
     atggaggaat ggatacaaaa acatgattcc gggctggacc tgacaacaag catggaacgc        60
     ctgcgggaca atccaagcgt ggagggaaag ctgcgctttt tcgcggagct gaaggccgcg       120
     cgtcttttgg tgccctgcca cggagaaaac ggcagcatcg cagcactgaa cacaccggaa       180
     aaggaagtgt tcctgcccgc gttctgctcg gcggacgagc tgcaaaaatg gactttcccg       240
     ttggaaaagg tgtccgtcct gccgctggac gcactgaaac atatagtcat tgataatccg       300
     gctcagcttg ccggtgtcgt tataaatcct ttcggtaagg ccctgttact gcggcacccc       360
     cagctggctg aaattgattc cggcaccgag gggatgacac tggcccgaac cgaccaccag       420
     ggtaagctgg atatccgcgc aacaacggat ttcccggtcg gcctgccaaa ggccctggcg       480
     cagctgcttg caacccggcc cgaggtttac cgcgcatgga tattactggc ccgtgaggaa       540
     aaagagacaa ggtaccataa gctgtttctc attgacttcg acggcgaccg gcggctgctt       600
     tttccccttg tggcaaaagc cgtacagccc tatatgaagc cgggtgaatc ctttgagctg       660
     atgaaggcgg actttggcct tctgcaaagg gctctagccg tatcggaacc ggtttatcaa       720
     aaaaagaagg cttga                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page