(data stored in ACNUC7421 zone)

EMBL: CP001720.PE39

CP001720.PE39        Location/Qualifiers
FT   CDS_pept        40101..41465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0040"
FT                   /product="germination protein YpeB"
FT                   /note="TIGRFAM: germination protein YpeB; PFAM: Propeptide
FT                   PepSY amd peptidase M4; KEGG: bha:BH1632 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61004"
FT                   /db_xref="GOA:C8VVD3"
FT                   /db_xref="InterPro:IPR014239"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVD3"
FT                   /inference="protein motif:TFAM:TIGR02889"
FT                   /protein_id="ACV61004.1"
FT                   /translation="MKKRYFAIPVLIGFLAILGLGYWGFKEQQTRKMAEAYVNNNYQRS
FT                   FYNLADHVQNMEVLLSKSLLVSEKKYDGKVYSDIWQHASAAQENLTQLPVNQSIVGRTS
FT                   KFLTQVGDYSRMMAAGAGSDTEISSDKWKTLNKLYLQSQELNKDLQTAQSNLMNGHVSI
FT                   QELAGESGSKMQGQAKRLASSNFQQINQKVQDYPALIYDGPFSDHLEKTKPRGVTGASI
FT                   GVSEARSKALGYIEQSQKTNLVAQVTDKTKGKIPSYRTEIYPQKDNKNKTVVEVTQQGG
FT                   HLIWLINTRTVGKSTVSIDAAIKKAQQYLAKHGYKNMMNTYYVREDGSVTINFSYLDKN
FT                   DIIYYDDLIKVTVALDNGDIIAVDAAGYLMSHYDRKLAPPKVTLAEAKKAVNKNVNIKG
FT                   GRLAVIPTDSGGEKLTYEFSGVLNKEIYLIYIDSQTGKQEKILKVIGTNNGTLTM"
     atgaaaaaac gttattttgc tataccggtg ttgattggat ttttggctat actgggtttg        60
     ggttactggg gttttaagga gcagcagaca agaaaaatgg cagaagctta tgtaaataat       120
     aattaccaga gatcctttta taacctggct gaccatgtgc aaaatatgga ggttttatta       180
     agtaaaagtt tgcttgtgtc ggaaaaaaaa tatgacggca aggtatacag tgatatctgg       240
     cagcatgcca gcgccgcaca ggaaaatctg acacaactgc cggtaaacca gtcgatagta       300
     ggacgaactt caaaatttct tacacaggtt ggcgattact cgcgtatgat ggctgcaggt       360
     gctggcagtg atacggaaat cagttcagat aagtggaaaa cattgaataa attatatctc       420
     cagtcgcagg agctaaacaa ggatttgcag acagcacagt caaacttgat gaacggacac       480
     gtaagcattc aagaactggc gggggaatcc gggagtaaaa tgcaaggaca ggctaaaagg       540
     ctggccagca gtaactttca gcaaataaac cagaaagtgc aggattatcc cgccctgatt       600
     tatgacggcc cgttctcgga tcacctggaa aaaacaaaac ccaggggagt gacgggagca       660
     agtatcggtg tgagtgaggc caggagtaag gcactgggtt atattgagca gtcacaaaaa       720
     acaaatctag tagcccaggt tactgataaa acaaaaggaa agatacccag ctacagaacg       780
     gaaatttacc ctcagaaaga caataaaaat aagacagtag ttgaagtaac tcagcaagga       840
     ggccacttga tctggttgat taacaccagg acggtaggca aaagcactgt cagtatagac       900
     gccgcgataa aaaaagctca gcagtacctg gctaagcacg gttataaaaa tatgatgaat       960
     acctattatg tccgtgaaga cggctcagtt actattaact tttcttatct tgataagaat      1020
     gacattatct attacgatga tttgattaaa gtaacggttg ctcttgacaa cggggatatt      1080
     attgcggttg atgctgccgg ttatttgatg tctcattatg atcgcaagct tgctcctcca      1140
     aaagtaactt tggctgaggc taaaaaagca gttaacaaaa atgtaaatat taaaggcgga      1200
     agattagccg taatacccac tgattcgggt ggggaaaaac tgacttatga gttttccggt      1260
     gtattgaata aggaaatata tttgatttat atcgacagtc aaaccggaaa acaagaaaaa      1320
     attcttaaag taattggcac gaataacgga acactgacca tgtag                      1365
//

If you have problems or comments...

PBIL Back to PBIL home page