(data stored in ACNUC7421 zone)

EMBL: CP001720.PE393

CP001720.PE393       Location/Qualifiers
FT   CDS_pept        complement(433134..433514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0421"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61358"
FT                   /db_xref="UniProtKB/TrEMBL:C8W506"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61358.1"
FT                   /translation="MGGGFRAGHFTLEDIKADHFFTSDQFSRKFSLAEVDIGVTWYSYG
FT                   EGKNMRDTSEDEMTLACMGALDAPPGEELRYTIKRNEVELPPVSPLTNTLKNINPIRIQ
FT                   MPAMASAQAVHMTSKTQNMYGN"
     gtgggcggag gctttcgggc gggccacttc acgctggagg acataaaggc ggatcacttt        60
     tttacaagcg atcagttttc gcggaagttc tccctggctg aagtagatat cggcgtcaca       120
     tggtattcct acggcgaagg gaaaaacatg cgggatacct cggaggacga gatgacactg       180
     gcatgtatgg gagcgcttga tgctccaccc ggtgaagaac tccggtacac gattaagcgg       240
     aacgaggtgg agcttccccc ggtttcccca ttgacaaata ctttgaagaa catcaatcca       300
     atccgaatcc agatgccggc gatggcatcc gcacaggctg tgcatatgac atccaaaacg       360
     caaaacatgt acgggaatta g                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page