(data stored in ACNUC7421 zone)

EMBL: CP001720.PE394

CP001720.PE394       Location/Qualifiers
FT   CDS_pept        complement(433750..438939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0422"
FT                   /product="cell wall/surface repeat protein"
FT                   /note="TIGRFAM: cell wall/surface repeat protein; PFAM:
FT                   protein of unknown function DUF291; S-layer domain protein;
FT                   KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61359"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR005102"
FT                   /db_xref="InterPro:IPR013378"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR042229"
FT                   /db_xref="UniProtKB/TrEMBL:C8W507"
FT                   /inference="protein motif:TFAM:TIGR02543"
FT                   /protein_id="ACV61359.1"
FT                   /translation="MKRNILRKALSLLLALVLLVPLASPAFAAEDIEESTLQSDAPMIL
FT                   GAGNGLAVWAGEKLAGGVVSSIAGYPMNQAMGKIFGTQTDQVLQALEAIKVQIQGLKND
FT                   IAEMSKKLDRQELRNFLNGYGDSINNYISVYNELSSAQKITDPAMLKILFEKIFKGEDP
FT                   NYMVGGNSLKNATINLGNQLRIVKAVEGGSCNIFGAIDLYDRYVNIWEHQGYVMREDFR
FT                   NKQLSIYTLFSAMSQLACQSIIDNNQGDTPSARLAKYQAESRMKDLKDDAELMDKMVKR
FT                   TSVVNPDNTISVYRHPNLRIARDIKQGIDLCAFSPDIKVAYVTKNAWGDEAAWADFSQS
FT                   AERYTSVDYLMSLTNDKTARRTAWSGGWEVYTNQPTPAEYQILRENYGGQQSLYNIFFD
FT                   ADKGNFNNVGNRPAELAFLCNHYVSRNCRDGWINWESNNHVGNNGEVYGWWKFSAARFI
FT                   SDTYAGSARDNWFDPSNAFIVNKYLGEVKQGSLQGPNSPPDIEYKATISGMDTEYEVGY
FT                   DSGITLEIDKTGDAYQWVVNKNDDKGFVELEGETGKTYSISDGLTSDMNGWQYSCTVID
FT                   NPAEPDGEPTYTHALPVTLNLTGDGISDPVTEHEVGDADALKTALDKVDSGEWNQHTLK
FT                   LADDITYPNPIAPDGMCSVTLDLNGYTLTVQPGANAESNVNAMSNNPQIAAICLNQDQL
FT                   TIEDSSIDGLGLLNIVAGPGIEYGIYAANDSGFDGYDAVTEEAVTVTSTVGGTAIYAAD
FT                   DSFVGVKGSVRAEGEDAYGIECLNSGSAVIVDKDVTVSGKSACGAYVASFDGGTSTQVV
FT                   RIFGDLTISGENSRAALLDAEAELTVRGSVTVTGGREGISVSNGYVETWGNVTAPDYAI
FT                   NARSNKASVVVLGNISVTRENAVAVSFVGAEIRVGGNVSSSNSGGVGILAATWMDPDDG
FT                   DVKCGASVTAEGKIVAVTPLLIESTPVTDESEKASTDLDYNVFTIPGKGTSAVKAMPGA
FT                   FEVKATSLVTFDKNGGDTEASPNTKAVITGGKAGILPTAPGRSGYTFNGWNTQVNGSGT
FT                   AFTANTDVTGPITVYAQWEYSVVNAAISPASASYDLNSPGDVSTAIIWNSASTITDVVY
FT                   GTTSLTTPAAYIVTESALTIKSSYLEEQGFSEGNTAEFMIDFDKGDSAKLTVNIVNNYI
FT                   LSDDAGLSDLKVGGSTVSGFDPNVFAYSVELPYDTLPGSQAATVSADVYNTKAVASITQ
FT                   AISLPGSAAVKVTAEDKTTTKTYTVNFTLEQAPTTYTITVQTDGNGTANANISSASQGT
FT                   QITLTANANNGYRFKEWQVIDGGVTITGNKFNMPASNVTVKVIFEYKSGGGSGGGGSSI
FT                   PTTPTIPAAGGTVSVNYTASNGTASLSLPMVKVNEIIEKSKSNEAVLDLSKVSGITAAS
FT                   IPKDVLATFAKAGLDTTVKLPVGTITLDEDATVSVAQQASGSNLAIELKQAATSSLTDE
FT                   QKKSVKSGDIVLDINITSGTKKISTFDGTLAVSMPYTGPQPVAVWYLNDGGELEKLDCT
FT                   FKNGVVSFNLDHLSLYVVGQDTAKPTWVNPFTDAKEADWFYAAVSFCAEKGITNGTSAT
FT                   TFSPNATLTREQFITMLLRAYGIEPIVNPSDNFSDAGSTYYTGYLAAAKDRGISNGVGD
FT                   NKFAPGKAITRQEMFTLLYNVIKFLNKLPTTDNGKTLADFTDSGDVATWARDAMIMLIK
FT                   SGTVSGSGGKLDPIGGSTRAQMAQVLYNLLGK"
     atgaagcgaa atattttaag aaaggcactc tcgctgctgt tggcactagt gttgctggta        60
     cctttggcat ccccggcatt tgccgccgag gatatagagg aaagcacctt gcagtcggat       120
     gcccccatga tcctgggcgc agggaatgga cttgccgtgt gggcaggcga gaagctggct       180
     ggcggcgtgg taagcagtat cgccggctac cccatgaacc aggctatggg caagattttc       240
     gggacacaaa cggatcaggt cttgcaagcc cttgaggcaa tcaaggttca aattcagggt       300
     cttaaaaatg atatcgcaga gatgtccaaa aagcttgaca gacaggagct tcgaaatttc       360
     ttgaacggct acggggattc catcaacaac tacatcagcg tttacaatga gcttagcagt       420
     gcgcaaaaaa taaccgatcc cgccatgtta aaaatccttt ttgaaaaaat atttaaaggg       480
     gaggatccga actacatggt cggcggcaat tcgctgaaaa acgctaccat aaacctcgga       540
     aatcagctaa ggatcgtaaa agcagtggag ggcggttctt gcaatatctt cggtgccatt       600
     gacctctatg accgatacgt gaatatctgg gagcatcaag gttatgtaat gcgggaggac       660
     ttccgcaaca agcagctgtc gatatacaca ttgttctcag ccatgagcca gcttgcctgt       720
     cagtcgatta tcgataacaa tcaaggagac actccgtcgg ccaggctcgc aaagtaccaa       780
     gctgagagtc gaatgaagga cttgaaggac gatgccgagc tgatggataa gatggtcaaa       840
     cgcacctccg tcgtcaatcc tgacaatacc atcagcgttt accggcaccc caacctgcgc       900
     atcgcccgtg acatcaagca ggggattgac ctgtgtgcgt tctcccccga catcaaagtc       960
     gcatatgtga ccaagaatgc ctggggggat gaagccgctt gggcggactt ttcgcaaagt      1020
     gcagagcggt atacctccgt ggattacctc atgagcttga cgaatgacaa aactgcccgg      1080
     cgcactgcat ggagcggggg ctgggaggtg tacaccaacc agccgacccc tgccgagtat      1140
     caaatacttc gggaaaatta cggcgggcag caatctttgt ataatatctt ttttgacgcg      1200
     gacaaaggca actttaataa tgttgggaat agacctgcgg aattagcctt tttgtgcaac      1260
     cactatgtct ctcggaattg ccgcgacggc tggatcaact gggaatccaa caaccatgta      1320
     gggaacaatg gagaggttta tggatggtgg aagttttctg cggcccggtt catttccgac      1380
     acgtatgccg gtagcgcccg cgataactgg ttcgatccct caaacgcctt catcgtcaat      1440
     aaatacttgg gtgaggtgaa gcagggctcg cttcaggggc ctaattcccc gccggacatc      1500
     gaatacaagg cgacaatttc gggcatggat acggaatatg aggtaggata tgacagcggc      1560
     atcactctcg aaattgacaa aaccggtgac gcgtatcagt gggttgtcaa caagaacgat      1620
     gacaagggct ttgtggagct tgagggagag acgggcaaaa cctactccat tagcgacgga      1680
     cttacctccg acatgaacgg ctggcagtac agttgcacag ttatagataa cccggcggag      1740
     cctgatggag agccaaccta cacccacgcg ctccccgtga cgctcaacct cacaggcgat      1800
     ggcatatccg acccggtgac cgagcatgag gtgggtgatg cagatgcgct caagaccgcg      1860
     ctggacaagg tggattccgg tgaatggaat cagcacacct tgaagctggc ggatgacatt      1920
     acctatccaa atcccattgc accggatggt atgtgcagcg tgacgctcga cttaaacggg      1980
     tacacgctga cagtgcagcc cggagcgaat gccgaatcga atgtgaatgc catgtccaac      2040
     aatccgcaga tcgccgcgat ttgcttaaat caagaccaac tgacaattga ggatagctca      2100
     attgacggtt tgggcttact gaacattgtc gccgggccgg gaattgaata cggcatctac      2160
     gcggcaaatg acagcggatt cgatggttat gacgcagtga cagaagaagc tgtcactgtg      2220
     acctccacgg ttggcggcac cgcgatctac gctgccgatg acagctttgt cggcgtaaaa      2280
     ggcagcgtcc gggcggaggg cgaggatgcc tatggcatag agtgcttaaa cagcggcagc      2340
     gctgtcatcg tggacaaaga cgtgacggtt tcgggcaaat ccgcctgcgg cgcatatgtg      2400
     gcgtccttcg acggcggtac ctcaacccaa gtcgtacgta tatttggcga cctcacaata      2460
     tccggcgaaa atagccgcgc tgcgcttttg gacgcggagg ctgaacttac cgtaagaggc      2520
     agcgtaacgg tgacgggcgg cagagaaggc atcagcgtaa gcaatggtta tgttgagact      2580
     tggggcaacg tcacagcgcc ggattatgct atcaacgccc ggagtaataa agctagcgtg      2640
     gtggtgctcg gcaatatctc tgtgacgagg gagaatgccg tggcggtgtc ctttgttggc      2700
     gccgaaatcc gtgtgggcgg gaatgtcagc tcgtcaaata gcggcggagt cggcatactg      2760
     gcggcaactt ggatggatcc cgacgacggc gacgtcaagt gtggcgcatc ggttacggca      2820
     gaaggcaaaa ttgttgccgt cacgcccctg ctgattgaga gcacgcccgt gaccgacgag      2880
     agtgaaaaag ccagcacgga ccttgattat aatgtattta ccataccggg aaaaggcaca      2940
     agtgctgtca aggcaatgcc cggcgcattt gaggtaaagg ccacctctct tgtcaccttt      3000
     gacaaaaacg gcggcgacac cgaggcaagc cccaatacaa aagcagtcat cacaggcggc      3060
     aaggcgggta tcctgccaac cgcacctggg aggagcggat ataccttcaa cggctggaac      3120
     acgcaggtca acggaagcgg aactgcattt acggcgaata ccgatgtcac cgggccgatt      3180
     actgtgtatg cacaatggga gtacagcgta gtaaatgcag ccatcagccc ggcaagtgcg      3240
     agttatgacc tgaacagccc cggcgatgta agtaccgcca tcatatggaa cagcgcttct      3300
     acgattacgg atgtggtata tgggacaacg tctttgacaa cacctgctgc atatatcgtt      3360
     accgaaagtg cgctaaccat caagagcagc tatcttgagg aacagggttt ttccgaagga      3420
     aatacggcag aatttatgat agactttgac aaaggcgatt ctgccaagct tactgttaac      3480
     atcgtaaaca attatatact ttccgatgat gccggtttga gcgatttgaa agtaggaggt      3540
     agcacagtaa gcggttttga tccgaatgtt ttcgcatata gtgtggaact gccatatgac      3600
     accctgcccg gcagccaagc tgcgacagta agcgcagacg tttataatac aaaggctgtc      3660
     gcaagtataa cacaagcgat atccctgccc ggcagtgcag ccgtgaaggt aaccgctgag      3720
     gataaaacaa ctactaagac ttataccgtc aacttcacgc tggaacaagc acctactacc      3780
     tataccatca ccgtccagac tgacggcaac ggtacggcaa acgctaatat tagctctgca      3840
     tcacagggaa cacaaattac tctgactgcc aatgcgaata acggctatcg gttcaaggaa      3900
     tggcaggtca tcgacggcgg tgttacaatt accggcaaca aattcaatat gcccgcctca      3960
     aatgtgacgg taaaggtgat ttttgaatat aaatcaggcg gtggctccgg cggtggcggc      4020
     agcagtattc cgaccacacc gaccatccct gcggcaggtg gcacggtttc tgtgaactac      4080
     accgcctcaa atggcacggc ctccctctcg ctgcccatgg tcaaggtcaa cgaaatcatc      4140
     gaaaagagca agagcaacga agcggtactc gacctctcca aggtaagcgg catcacggcg      4200
     gcgtccattc ccaaggatgt gctggcaacc tttgcaaaag cgggtcttga cacgactgtc      4260
     aagctgcctg tcggcaccat cacccttgac gaggatgcaa cagtctcggt tgcgcagcag      4320
     gcttccggca gcaatctggc cattgaattg aaacaggcgg caaccagctc tctcaccgac      4380
     gaacaaaaga aatcggtcaa gagcggcgat attgtgctgg acatcaacat cacctccggc      4440
     acgaagaaga ttagtacctt tgatgggacg ctcgccgttt ctatgcccta taccggcccg      4500
     cagcctgtag ccgtatggta tttgaacgac gggggcgagt tggagaaact tgactgcact      4560
     ttcaaaaacg gcgtggtcag ctttaacctt gaccatctct ctctctatgt ggtggggcaa      4620
     gacacagcga agcctacgtg ggtcaatccc tttaccgatg cgaaggaagc cgattggttc      4680
     tatgcggcgg tcagcttctg tgcagagaaa ggtatcacca acggcacatc ggcaacgaca      4740
     ttcagcccca acgcaacact gacacgcgaa cagtttatca ctatgctgct gagagcctac      4800
     ggcatcgagc caattgtaaa cccctccgac aactttagcg atgctggcag cacctactac      4860
     accggctatc tcgcagcggc caaggatagg ggtatttcca atggcgtagg cgataacaaa      4920
     ttcgctccgg gaaaagcaat tacccggcag gagatgttta cgctattgta caacgtcatc      4980
     aagtttctga acaagctgcc caccacagat aatggcaaga cccttgccga cttcaccgat      5040
     agcggcgatg tggcaacttg ggcgcgtgat gccatgatta tgttaattaa atctggcaca      5100
     gtttccggca gcggcggtaa gctcgatccg ataggcggtt cgacccgcgc gcagatggcg      5160
     caggtgctgt ataacctgtt ggggaagtaa                                       5190
//

If you have problems or comments...

PBIL Back to PBIL home page