(data stored in ACNUC7421 zone)

EMBL: CP001720.PE395

CP001720.PE395       Location/Qualifiers
FT   CDS_pept        complement(439141..440076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0423"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain-containing protein
FT                   AraC type; SMART: helix-turn-helix- domain-containing
FT                   protein AraC type; KEGG: scl:sce7020 AraC family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61360"
FT                   /db_xref="GOA:C8W508"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:C8W508"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ACV61360.1"
FT                   /translation="MKYITVNEAAEKWGLSRRSISHHLTAGRIPGAVKKGGFWLIPKDV
FT                   AKPKDKRYKKSTGKTEESFGSPPSLTENKDLFVEMFKHFPYPVQICDPEGAMLFANAAF
FT                   FRHIKLSDPPEDLRIFNTRYEPNLEKWGIKDFVERAYRGEVAHIYDVKMPIREAVSKYG
FT                   GNAELPSESIFVNMTSFPIYDENHQIAYVVGIFIPSRYYQGREEVIQGKEYMDDHWKED
FT                   FDADALSSIVHISKPHYTRLFKQHTGTTPHQYYQGVKLQKLKEMLCDNNLSIAQVFDEC
FT                   GVNYNGNLAKKLKQELGMTPSEYRARMMQK"
     atgaaatata tcacagtcaa tgaagcggca gaaaaatggg gtctttctag gcggtcaatc        60
     agccaccatt tgacagccgg ccgcattccg ggtgcagtaa aaaagggcgg cttctggcta       120
     atccccaaag atgtcgcaaa acccaaagat aaaagatata aaaaatccac aggaaaaaca       180
     gaagagtcct tcgggtcgcc accatcactg actgaaaaca aggatttgtt tgtggaaatg       240
     ttcaagcatt ttccttatcc ggtacaaata tgcgatccgg agggtgcaat gttatttgca       300
     aacgctgcct tttttaggca tataaaattg tccgatccgc cggaggattt aagaatattt       360
     aatacgcgct atgagccgaa ccttgaaaaa tggggcatca aggattttgt cgagcgagcc       420
     tatcggggag aggtcgctca tatctacgat gtcaaaatgc cgattcgaga ggccgtctca       480
     aagtatggcg gcaatgcaga attgccctca gaaagcatat ttgtcaatat gacctctttt       540
     cccatctatg atgaaaatca tcaaatcgca tatgttgtgg gcatttttat cccttctcga       600
     tactatcagg gccgggaaga agtgatacag ggcaaggaat acatggatga tcactggaaa       660
     gaggactttg atgcggatgc gctttcaagt atcgtccaca ttagcaagcc acattatacc       720
     cgcctgttca agcagcacac cggcacgacg ccccaccagt attatcaggg tgttaagctt       780
     caaaagctca aggaaatgct gtgcgacaac aacctgtcca ttgctcaggt tttcgatgaa       840
     tgcggtgtga attacaatgg gaatctagcg aaaaaactaa aacaggaatt gggcatgaca       900
     ccgtccgagt atcgggcaag gatgatgcaa aaatag                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page