(data stored in ACNUC7421 zone)

EMBL: CP001720.PE396

CP001720.PE396       Location/Qualifiers
FT   CDS_pept        complement(440204..440755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0424"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61361"
FT                   /db_xref="UniProtKB/TrEMBL:C8W509"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61361.1"
FT                   /translation="MGELIQRMSTQTRSCLEQEIAEKPNAAIADAINAAYRLLSESVVY
FT                   DGISMSDRAVLLGDDEPYIQVKLIANSDELDLDEEDGIWVNCPVHEDELKAVAEQLGVG
FT                   SYRDLEMGDVCAIVEKTTIDMLCDAISSFDEINELARAMKEHGVIRELGKYKAILEFEN
FT                   CFDVEEAAELAGKLDDYDFF"
     ttgggagagc tgatacagcg tatgtcgaca caaacgcgct cctgcttgga gcaggaaatt        60
     gcagagaaac ctaatgccgc cattgccgat gccatcaacg ccgcataccg actgctgtcg       120
     gaaagcgtgg tatatgacgg gatatccatg tcggaccggg ctgtgctttt gggtgatgat       180
     gagccataca ttcaggttaa gctcattgcg aacagcgatg agctggatct ggacgaagaa       240
     gatggaatat gggtaaactg ccctgtccat gaggacgagc tgaaagctgt agccgaacaa       300
     ctgggtgtcg gctcataccg tgatcttgaa atgggcgacg tttgtgccat cgttgagaaa       360
     actacgatag atatgctctg cgatgcaatc tcttccttcg acgagattaa cgagctggca       420
     cgcgctatga aagagcatgg tgtaatccgg gagctgggca agtataaagc cattctggaa       480
     ttcgaaaact gttttgacgt agaagaagcc gccgagttag caggaaagct ggatgactat       540
     gattttttct aa                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page