(data stored in ACNUC7421 zone)

EMBL: CP001720.PE397

CP001720.PE397       Location/Qualifiers
FT   CDS_pept        complement(440845..441048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0425"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61362"
FT                   /db_xref="UniProtKB/TrEMBL:C8W510"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61362.1"
FT                   /translation="MKRILSILLITLLITMFLPMTAFAIGDGNVDGGGGMGDGTSTDYW
FT                   NTGDEGVHLDYFGDVGVETIDT"
     atgaaacgaa tactcagcat attgctaatt accctgctga taacgatgtt tctgccaatg        60
     actgcctttg ctatcgggga tgggaatgtg gatggaggcg gcgggatggg tgacggtaca       120
     agcacagatt attggaacac cggtgatgaa ggtgtacatc tggactattt tggggatgta       180
     ggagtggaaa ccattgatac ctga                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page