(data stored in ACNUC7421 zone)

EMBL: CP001720.PE399

CP001720.PE399       Location/Qualifiers
FT   CDS_pept        complement(445028..445678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0433"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61364"
FT                   /db_xref="UniProtKB/TrEMBL:C8W512"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61364.1"
FT                   /translation="MKTVYAFIRHQGNSLAVDFPLNIYDMPDHLGSIGVRLPPGKVAVA
FT                   DTKDLSVKLTGLNEVGEAIVEKLAGSDSLVDINTLCQAIEQACPYGYEDMADRLAASDS
FT                   KSAKELMQVVDEFIQTQQSQQMGGILRRFLYIRRRLFVAGKEAASMDKGKKSQQKQENG
FT                   DAHAPPGKRYTVPPPKDTTRCKGCPYPRVGFICWKLPADRYGQDRQAGEVRTD"
     atgaaaactg tttatgcttt tattcggcat caagggaaca gcctggcagt ggatttcccc        60
     ctaaacattt atgatatgcc tgatcatctc ggaagtattg gagtccggct gcctccgggc       120
     aaagtagctg ttgcggacac aaaggatttg tctgtcaaac tcacaggatt aaatgaggtt       180
     ggtgaagcca ttgtcgaaaa gctggccggc agcgatagcc tcgttgacat caatacgctc       240
     tgccaggcaa tagaacaagc ctgcccatat ggttatgaag atatggctga cagactggca       300
     gccagtgatt caaagagtgc aaaagaatta atgcaggtgg tggatgaatt catccagaca       360
     caacaatctc aacaaatggg aggcatattg aggcgctttc tttatataag gaggcgcctt       420
     tttgttgccg gaaaggaggc cgcatcgatg gataaaggca aaaaatcaca acagaaacaa       480
     gaaaacggcg acgctcacgc accgccagga aaacgatata ccgtcccgcc cccgaaagac       540
     acaacacgct gcaaaggctg tccgtatccc cgtgttggct ttatctgctg gaagctgcct       600
     gcggaccgat atggacagga tcggcaggcc ggggaggtga ggacggattg a                651
//

If you have problems or comments...

PBIL Back to PBIL home page