(data stored in ACNUC7421 zone)

EMBL: CP001720.PE4

CP001720.PE4         Location/Qualifiers
FT   CDS_pept        2952..4082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: baa:BA_0599 RecF protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACV60969"
FT                   /db_xref="GOA:C8VVA0"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVA0"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ACV60969.1"
FT                   /translation="MRIKELFINNFRNYKSLHIKPKENLNIFIGDNAQGKTNILEAICF
FT                   LLQGRSFRTSHEKEIINFDSEQSKLKTELKAYNQNYSIDISLSRTKPKIIKINNSTTSK
FT                   PELATNFGTIVFTPDQLSIIKGSPKERRRFLDLELASFYPQYKYYFVNYQKVLLQRNNL
FT                   LKELKEKKQADTFDLLELWDNQLISYGAKILMARMEILKKLIPMAQQIHNQITSDKEKL
FT                   TIRYRSSLNLNSNFREELIYDQFREVILKNRQQDYLKGQTTVGPHRDDLVFLINNKNIT
FT                   DFGSQGQQRTIILTLKFAIINLWSCELNDVPVLLLDDVFFELDSKRQKYIFDLLNKDVQ
FT                   VFITSTGMANTEKNLINIKKNAIFNVRSGLVCEEEL"
     ttgcgaataa aagaattatt tattaataat tttcgcaact acaaaagttt gcatataaag        60
     cccaaggaaa acttaaatat ttttataggt gataatgccc agggtaaaac taatatactg       120
     gaagctatat gttttttatt gcaaggaaga tcttttcgaa cttcacatga aaaagaaatt       180
     ataaattttg attctgagca atctaaatta aaaactgagt tgaaagctta taaccaaaac       240
     tattcaattg atataagttt aagcagaaca aagccaaaaa ttattaagat aaacaattcc       300
     actaccagta aacctgaact tgctactaat tttggcacta tagtatttac tcctgatcag       360
     ttatcaataa taaaaggctc acctaaagag agaagacggt ttttggattt ggaattagca       420
     agtttttatc cccaatataa atattatttt gtcaactatc aaaaagtact gctccagcgc       480
     aataatcttc taaaagagtt aaaagaaaaa aaacaagctg atacttttga tttactggaa       540
     ctttgggaca atcaattaat tagttatggt gctaaaatct taatggccag aatggaaatt       600
     ttaaagaaat taatcccaat ggctcagcag attcataatc aaataacatc agataaagaa       660
     aaattaacaa taaggtacag atcaagcctg aatttaaaca gcaatttcag ggaagaacta       720
     atatatgacc agtttagaga ggtaatatta aaaaacaggc agcaagatta cttaaaaggc       780
     cagacaacag ttggacctca tcgtgatgat ctggtttttt tgattaataa taaaaatatt       840
     acggattttg gttcgcaagg acaacaaaga actattattt taaccttgaa atttgctata       900
     ataaatcttt ggagttgcga gttaaacgat gtaccggtac tattgctgga tgatgttttt       960
     tttgaattgg acagtaaaag acaaaaatat atttttgatt tattaaataa ggatgttcag      1020
     gtatttataa cttcaaccgg tatggctaat actgagaaaa atttaattaa tataaaaaag      1080
     aatgcaatat ttaatgtacg cagcggttta gtttgtgagg aggaattata g               1131
//

If you have problems or comments...

PBIL Back to PBIL home page