(data stored in ACNUC7421 zone)

EMBL: CP001720.PE40

CP001720.PE40        Location/Qualifiers
FT   CDS_pept        41935..43143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0041"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; aromatic
FT                   amino acid beta-eliminating lyase/threonine aldolase;
FT                   aminotransferase class V; KEGG: bha:BH3350 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61005"
FT                   /db_xref="GOA:C8VVD5"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVD5"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ACV61005.1"
FT                   /translation="MSEVVKMEERKGSPDWSEFINPVLKSLPPSGIRRFFDLVSEMKDV
FT                   VSLGVGEPDFVTPRNIIDACVRSLDNGQTGYTSNQGMLELREAIAEEINGSYGVKYDPV
FT                   SEILITVGVSEALDLAMRALISPGDEVLIPEPTYVSYIPCAALAYAKTVPLKTNMDKLF
FT                   RVTAEQVEKAITPRTKILLLAYPNNPTGAVMTRQELLDICEVVKAHNLIVISDEIYEHL
FT                   TYIEPHTCVSSLPGMKERTILLSGFSKSYAMTGWRAGYACGNPDFIGAMTKIHQYSMLC
FT                   APTQAQVCALEALRSGKPDMRRMTAEYNKRRKLVVDAMEEIGLPCFEPGGAFYAFPDIT
FT                   KTRMNAAEFSERLLMEEKVAVVDGTAFGEAGEGHVRISYAYSVEKLTEAFRRMNRFVKR
FT                   YSS"
     gtgagtgaag ttgttaaaat ggaggagcgg aaaggtagtc cagactggtc ggaatttata        60
     aatccggttt taaaatcttt gcctccgtcc ggtatacgcc gtttttttga tttagtttcg       120
     gaaatgaaag atgttgtgtc tctgggggtg ggtgaacctg actttgttac tccacgaaat       180
     attattgatg cttgcgtcag atcacttgac aacggtcaga ccgggtacac ctcaaatcaa       240
     ggtatgctcg agctcagaga agctattgct gaagaaatta acggttccta tggtgtaaag       300
     tatgatcccg tgtcggaaat ccttattacg gtaggtgtca gtgaggcctt ggatttggct       360
     atgcgggcct tgatttcacc gggggatgaa gtgcttattc cggaaccgac atatgtttcc       420
     tatatacctt gcgctgcttt agcctatgcc aagacagtgc ccttaaagac caatatggat       480
     aaattattca gagtaaccgc tgagcaagtt gagaaggcta ttacgccgcg tacaaaaata       540
     ctgttgctgg cttatccgaa taacccaacc ggagctgtga tgaccagaca ggaattgttg       600
     gatatttgcg aagttgttaa agcgcataac ctgattgtta tttcagatga gatatacgaa       660
     cacctgacct atattgaacc tcatacctgt gtatccagcc tgccgggcat gaaggagcgc       720
     actatcttgc tgagcggctt ttccaagtct tatgctatga ccggctggcg ggccggttat       780
     gcttgcggca atccggactt catcggtgcc atgaccaaaa ttcaccagta ttctatgttg       840
     tgtgccccga cacaggctca agtttgtgct ttggaagcgc tcaggagcgg taagcctgat       900
     atgaggagaa tgactgcaga gtataataag cggagaaaac ttgtggtgga tgccatggag       960
     gaaataggtt tgccatgttt tgagccgggc ggcgcgtttt atgccttccc cgatatcact      1020
     aaaacgagaa tgaatgccgc cgaattttct gagcgcttgc tgatggagga gaaagtggca      1080
     gttgttgacg gtactgcttt tggtgaagca ggtgaaggcc atgtaaggat ttcctatgct      1140
     tattccgtgg agaaattgac ggaagctttt aggcgaatga atcgttttgt aaagagatat      1200
     tccagttaa                                                              1209
//

If you have problems or comments...

PBIL Back to PBIL home page