(data stored in ACNUC7421 zone)

EMBL: CP001720.PE401

CP001720.PE401       Location/Qualifiers
FT   CDS_pept        complement(446380..447792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0435"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; SMART: regulatory
FT                   protein LuxR; KEGG: gsu:GSU2670 LuxR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61366"
FT                   /db_xref="GOA:C8W514"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C8W514"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ACV61366.1"
FT                   /translation="MLKLGGWAGDSISLTLLFTWILSYPMHGFFLQGVAGPNFYVLGHL
FT                   FTASHGLGLFTIGSLSITMLQNKTFIKLAGVSVLVLTIAYTILPQSGSIKYIICIILGF
FT                   SSAYLVLAWACVFTGSNIAPELTLGVAMALTNVLLGLIGFAHNIPKTAFITASALSGLA
FT                   PLISAFYITRKQPSVKLQNVQNEQKDIKAGLTTFLGIAFLVAAAFFSGGLWYRAVLPLF
FT                   HLKWPDIMGIGSFIYAAAVLGLSLNAQKHSLYWLGTISLSALGIGLATSLIGLDKSVVL
FT                   ALTLIILAAGLGALDLFFWLTLRKLSLFLGTQRSFGFGLGLSLFFITAPGIAIDTGVLT
FT                   NPLESPVMSVIGACLLFLINPLLVQLLQHLSVSLPKHDGVYDSFHEPTATNKGEENQTV
FT                   THYPEFWYNFTASEKRVYEFICKGWTDPEIAAHLNISRHTVKFHVRNLLRKAGVSNRKE
FT                   LLAQLVSNRDEK"
     atgttaaaac ttggcggatg ggcgggcgat tccatatccc taaccttgtt gtttacatgg        60
     atactaagct acccgatgca tggctttttc ctacaaggag tagccggtcc taatttttac       120
     gttttaggac acctttttac tgcaagccat ggtttgggac tttttacaat cggttcatta       180
     tctataacca tgctccaaaa taaaactttt ataaaactgg ccggagttag tgttttggtt       240
     ctgacgattg catatacgat tcttccacaa agcggttcta ttaaatatat aatttgcatt       300
     attttaggct ttagctctgc ctacctggtc ttggcttggg cctgcgtctt taccggcagc       360
     aatatagctc ccgagctgac tctcggtgtg gctatggctc tcaccaatgt tttgctcggt       420
     ctgattggat tcgctcataa catccctaaa acagcattta taactgcttc agcactttcc       480
     ggactggccc ccctcataag tgctttttac attacccgga aacaaccttc agtaaaactt       540
     caaaatgttc agaatgaaca aaaagatata aaggccggat taactacctt tctcggaata       600
     gcgttcttgg tagccgcagc ttttttttcc ggaggcctct ggtacagggc tgtgctgcca       660
     cttttccact tgaaatggcc ggatataatg gggataggtt cctttatata tgccgctgca       720
     gttttaggcc tgtctttaaa cgcccaaaag cattctttat actggctggg gactatcagc       780
     ctaagtgcac ttgggatagg actggcaaca tcgttaattg gtcttgacaa atcggtggtg       840
     cttgccttaa cgttaatcat tctggctgcg ggccttggag cattggactt atttttttgg       900
     cttacactgc gaaaattatc tctatttctc ggcacccaga ggtcctttgg ctttggcctg       960
     ggactatccc ttttttttat aactgccccc ggaatagcca tagacacagg cgttttgaca      1020
     aacccgttgg aaagccctgt aatgtctgtg ataggagcct gtcttttgtt tttgattaac      1080
     cctttgctag tacaactgct ccaacatctg tcggtttcac tacccaagca tgatggagtt      1140
     tatgattctt ttcacgaacc aacggcaaca aacaaagggg aagaaaacca aacagttacc      1200
     cattacccgg aattttggta taatttcaca gccagtgaga aaagagtgta cgaattcatc      1260
     tgtaagggct ggaccgaccc ggaaatcgca gctcatttga atatctctcg ccacaccgtc      1320
     aaatttcacg taagaaattt actcagaaaa gccggggttt ccaatcgaaa ggaactgctg      1380
     gctcaacttg tcagtaaccg ggatgaaaaa taa                                   1413
//

If you have problems or comments...

PBIL Back to PBIL home page