(data stored in ACNUC7421 zone)

EMBL: CP001720.PE402

CP001720.PE402       Location/Qualifiers
FT   CDS_pept        448277..451957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0436"
FT                   /product="S-layer domain protein"
FT                   /note="PFAM: S-layer domain protein; Ig domain protein
FT                   group 2 domain protein; SMART: Ig domain protein group 2
FT                   domain protein; KEGG: baa:BA_1469 SLH, S-layer homology
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61367"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR003343"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:C8W515"
FT                   /inference="protein motif:PFAM:PF00395"
FT                   /protein_id="ACV61367.1"
FT                   /translation="MHNNRLFIVVLIIYMLLIFTGYAVAAEFSDISGHWAQGQINKWAE
FT                   KGLVSGYQDGTFKPNNQISRAEFVAMINRAFAIDKGNTTADFTDVKPGKWYYEEVISAK
FT                   TAGYIGGYVDGTFKPDQTITRQEVASILVRLLKINPSIEGLAKFGDAGQIQEWARGSVG
FT                   AAAKAGLMRGMPDNTFKPIRSITRAEAVVSLHNALAYASGEPKTVEEPKTVVGTTLEGT
FT                   VTLDGSALDKVVVRIFAADSHKVLKEVQTDNQGYFKAELKAGYYDITATTDSAVAYKAD
FT                   VNIVENKIAEINLNLEDAAIVKGILKDNNGRAVKNATILFTTNPTFITSTNINGEYTIA
FT                   VMADRTYTVRAYEQIHNDKEPSVVTSSQHVGSAGTQNIGTLKAPFTLAYTGGSSGGGSS
FT                   SNTQIISINTIDNLSIINGSTGQKTITTSPTDVTIKAFSSSEQVAGVTVLSKTMTISAN
FT                   EAGNATITVTAEKSGYESTTRTFTVNVIEKDKSIPLDNPVIIPEDAKKLEFTNGVQLDF
FT                   SVITIPAENTLTVTELSDSDYEVPSVQEGQVFKTAGKVVKIELQGNVDLNKGVNLVLPF
FT                   EGDPGADLAIFYFDNGEWKYMDSIVDVSNKVIQTTVYHFSNWAPFKASQVAKPEASTAS
FT                   GEIEKGTNVSLTTTSEGATIYYTTDGTVPTIRSSKYTGPIGINSNLTIKAIAVKSNMRN
FT                   SDEATFEYTVTEVPVTGIDVSLVKMDLTVEKTLEIDATVIPENATNKNVAWTSSNEEVA
FT                   TVSSSGLVTGVGVGVATITATTKDGGFAATCEVTVTAASPQTPVELEIICSSEREIWVS
FT                   VWNVSGNEHEPLLKLDRENFLLSDANGNEVEFKFNDPEVRDPDIPEHEYLLSPTEGEFT
FT                   GTNKLTFTKAGYQSGSKLFTIVSGDEGPFTPGEGGILPAFDPFTPQQNTIGCLYSVKSQ
FT                   RENRWLGGTEPVVELRFSPASQNDAESYTLQYSTNGTNWQNYQVYSEDLKSSATQDNFS
FT                   LSNPGGSYYYRLLVNGGPKNGYTSNAVAAPLSNINTYFSGWSLDESVYISGTMAPWIGR
FT                   GLEAAFTVKSLEEQSVVDEVYLSCQWYRVNPATYEMELIDGATSLTYITNESDAGYKLL
FT                   IQATGDGINIGGFEQVMSGFKNVLPNKAFASDVTDSGFTLNLYKSVDNLTSDVLILRNS
FT                   NDDLVPIISVTPVGSSKAKFTINADIPATNGPYRLENKSDFWLLMEEKEQGYMHEGLTI
FT                   E"
     gtgcataaca atagactatt tattgtcgta ctaatcatat atatgcttct aatctttacg        60
     ggttacgcag tagctgccga attttccgat atatccggcc attgggccca aggacaaatt       120
     aataaatggg ccgaaaaagg cttggtcagt ggttaccagg acggaacatt caaacctaac       180
     aaccaaatca gccgagctga atttgtagcc atgatcaacc gtgcctttgc cattgacaag       240
     ggcaatacca ccgccgattt taccgatgtt aaacccggta aatggtatta cgaagaggtg       300
     atttcagcca aaacagcagg atatatcggc ggctatgtcg acggcacatt caagcctgac       360
     caaaccatca cccgtcaaga ggtagccagt atattagtca gactgctaaa aattaacccg       420
     tctatcgaag gactggccaa attcggcgat gccggccaga ttcaggaatg ggccaggggc       480
     agcgttggcg cagctgccaa ggccggttta atgaggggca tgcccgacaa cacctttaaa       540
     ccgatacgga gcatcacccg ggccgaagcc gtggtttccc tgcacaacgc tttggcatac       600
     gcatcgggcg aaccaaaaac cgtggaggaa ccaaaaaccg tagtgggaac tacgttggaa       660
     ggtacagtaa cccttgacgg cagtgcttta gataaagtag tggtgcggat ttttgccgcc       720
     gacagccata aagtactaaa agaagttcaa actgataatc agggttactt caaagccgaa       780
     ttaaaagccg gttattacga cataactgct accaccgaca gtgcggttgc ttataaagcc       840
     gacgttaata tcgttgaaaa caagattgcg gaaattaacc taaaccttga agacgcggct       900
     atcgtaaaag gtatcttgaa agacaacaat ggccgggcag taaaaaatgc cactatctta       960
     ttcaccacta acccaacctt cattacctcc accaacataa atggtgaata taccatagcg      1020
     gttatggctg acaggaccta cactgtccgt gcttatgaac aaatccataa cgataaggaa      1080
     cccagcgttg tgaccagcag tcagcatgtc ggttccgccg gtacccagaa tattggtact      1140
     cttaaggctc ccttcaccct ggcctacacc ggtggcagca gtggtggtgg tagtagttcc      1200
     aatacccaaa ttatatcaat aaataccatt gacaacttat ctataatcaa cgggtcaacc      1260
     ggccaaaaaa ctattaccac cagccccaca gacgttacga ttaaggcttt cagcagcagc      1320
     gaacaagtag ccggtgtaac cgttttgagc aaaacaatga caattagtgc taatgaggcc      1380
     ggcaatgcaa caattaccgt gactgctgaa aagtccggtt atgaaagtac aacccgaact      1440
     ttcacggtta atgtaataga gaaagataaa tcaataccgc tggacaatcc ggtaataatt      1500
     ccggaagatg caaagaaact ggaatttaca aatggcgttc aattggactt ttccgtgatt      1560
     accattcccg ctgaaaacac gttgaccgtt acagaactaa gcgacagtga ttatgaggta      1620
     ccctctgttc aggaaggtca ggtatttaaa accgccggga aagttgtcaa aatagagctt      1680
     cagggcaatg tagacctcaa taaaggtgta aatttggtac tgccatttga aggtgaccct      1740
     ggcgctgacc tggcaatttt ctactttgac aacggcgaat ggaaatatat ggattcgatt      1800
     gtggatgtat ctaataaagt tattcaaacc actgtttatc atttttccaa ttgggcaccg      1860
     tttaaagctt cgcaggttgc taaaccggaa gcgagcaccg catccgggga aatagaaaag      1920
     ggcacaaatg ttagtttaac aacaacttca gaaggtgcaa ccatctacta cacaactgat      1980
     gggactgttc cgacaattag aagcagcaaa tataccggac cgattggcat aaacagtaac      2040
     ctgaccatta aagccattgc tgtaaaaagt aatatgagga acagtgatga ggcgacattc      2100
     gagtacaccg ttactgaagt ccccgtaacc ggtatagatg tcagtttggt aaagatggac      2160
     ttaacagtag aaaaaactct tgagatagac gcaacagtga ttcctgaaaa cgcaacaaat      2220
     aaaaatgtag cttggacttc aagcaatgaa gaagtagcaa ctgtaagtag cagcggttta      2280
     gtaacaggag tgggtgtagg cgtcgcaact atcacagcaa ctacgaaaga tggtggattt      2340
     gcggcaacct gcgaggtcac cgtaacggcg gcatctcccc aaactcctgt ggaattggaa      2400
     atcatctgtt cctctgagag agaaatatgg gtatcggttt ggaatgtatc tggcaatgaa      2460
     catgagccgc tacttaaact ggatagagaa aattttttgc tgtctgatgc taatggaaat      2520
     gaagtggaat tcaagtttaa cgatccggaa gttcgagacc ctgatattcc tgaacatgaa      2580
     tacttgctaa gccctactga aggtgaattt acaggaacta ataaattaac atttaccaaa      2640
     gcaggctatc agtccggcag caagttattc actatagttt ctggagatga aggtccgttt      2700
     acgccaggtg aaggaggaat acttcccgcc tttgaccctt tcacacccca acaaaatacc      2760
     attggctgtt tgtattcagt caaaagccag cgggaaaaca ggtggcttgg cgggacggaa      2820
     cccgtagtgg aactaagatt ctcaccggcg tctcagaatg atgccgagag ctatactctg      2880
     cagtattcta cgaacggcac aaactggcaa aactatcaag tatattctga ggatttaaaa      2940
     agctcggcaa cccaggacaa tttcagcctt tctaatcccg gcgggtccta ttactaccgt      3000
     cttttggtaa atggcgggcc taaaaatggc tatacatcaa acgctgtagc tgcaccgtta      3060
     tccaatatca acacatattt cagcgggtgg tccctggatg aaagcgtgta tattagcggg      3120
     actatggcgc cctggatcgg caggggcctg gaggcagctt ttactgttaa aagtctcgag      3180
     gaacagtcag tggtggacga agtatattta agctgccagt ggtacagagt aaatccggct      3240
     acttacgaaa tggaacttat cgacggagcg acaagcttaa cctatattac aaacgaatcg      3300
     gacgcaggct ataaattgct tatccaggca acgggagatg ggataaatat aggtggtttt      3360
     gagcaggtaa tgtccggttt taaaaatgta ttgcccaaca aagcctttgc ctcagatgta      3420
     actgacagcg gatttacgct caatctctat aaaagcgtgg acaatctgac aagcgatgtt      3480
     ttaattcttc ggaattccaa tgatgatctc gttcccatta tttctgtaac gccggtggga      3540
     agcagtaaag caaaattcac catcaatgca gatattccgg caaccaatgg gccgtaccgt      3600
     ttggaaaaca aatcagattt ctggctgctt atggaagaga aggagcaagg atacatgcat      3660
     gaggggttaa ccattgagta a                                                3681
//

If you have problems or comments...

PBIL Back to PBIL home page