(data stored in ACNUC7421 zone)

EMBL: CP001720.PE403

CP001720.PE403       Location/Qualifiers
FT   CDS_pept        complement(452128..452685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0437"
FT                   /product="flavin reductase domain protein FMN-binding"
FT                   /note="PFAM: flavin reductase domain protein FMN-binding;
FT                   KEGG: sfu:Sfum_3444 flavin reductase domain protein,
FT                   FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61368"
FT                   /db_xref="GOA:C8W516"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:C8W516"
FT                   /inference="protein motif:PFAM:PF01613"
FT                   /protein_id="ACV61368.1"
FT                   /translation="MEKLKIKNYPMVSPAPTVLVGADVNGKPNYATVGAFGMVCLEPVF
FT                   YVSLKSTHYTTIGVKENGYFSINVPSADMVQITDYCGIVSGKTTDKSIVFTSFYDELKK
FT                   APMISECPLNFLCKIIQIVPIYGFEVFFGEIVSTYLNKQCLTGNKPDPLKINPMIMMGT
FT                   SYFDLGQAVGNLFKEGVEYKKL"
     gtggaaaaat taaaaatcaa aaattatcct atggtaagtc ctgctccaac tgtccttgtc        60
     ggagccgatg taaatggcaa gcctaactat gccaccgttg gggcatttgg tatggtgtgt       120
     ctggaaccag tgttttacgt ctcattaaaa agcactcatt atacaactat tggggttaag       180
     gaaaatggat attttagtat caatgtaccc tcggcagata tggttcaaat aacagattat       240
     tgcggtatag tatcgggaaa aacaacagac aagtcaattg tgtttacttc gttttatgat       300
     gaacttaaaa aagctcccat gattagcgaa tgtccattga attttctctg caagatcatt       360
     caaatagttc ctatttacgg ctttgaagtg ttctttgggg agatagtttc tacataccta       420
     aataagcaat gcttgacggg caacaagccc gatccgctaa aaatcaatcc gatgattatg       480
     atgggcacca gttactttga tttaggtcag gctgtgggga atttgttcaa agaaggtgtg       540
     gaatacaaaa aattgtaa                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page