(data stored in ACNUC7421 zone)

EMBL: CP001720.PE405

CP001720.PE405       Location/Qualifiers
FT   CDS_pept        453733..455799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0439"
FT                   /product="cytidyltransferase-related domain protein"
FT                   /EC_number="6.2.1.22"
FT                   /note="KEGG: vha:VIBHAR_05301 citrate lyase ligase;
FT                   TIGRFAM: cytidyltransferase-related domain protein; PFAM:
FT                   Citrate lyase ligase domain protein; SMART: Citrate lyase
FT                   ligase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61370"
FT                   /db_xref="GOA:C8W518"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005216"
FT                   /db_xref="InterPro:IPR013166"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C8W518"
FT                   /inference="protein motif:TFAM:TIGR00125"
FT                   /protein_id="ACV61370.1"
FT                   /translation="MNHFYYYELCEILSFVAAGKLAVLNSIEEESENYIQFFRKNHIDV
FT                   INNENNQIQEKDLFFIYTIYSENGVNKIIDSGCEFILPIMEYSGQLPMQSLKERVAKLQ
FT                   GHFQNRTGKLILLSDQKTCDLFEELNFIPDFFINTSGFIESNTERVNPKPGVPRNAFFL
FT                   IYTSVELGQLFEKLKYYQAFYFANDEKVHLPTVYLINKIGKLKRDKNVKVYYFNPPVLA
FT                   AVKHPSENEKMIMDAFSKCTLYEFIGMLIEGKFHDSLVNHKLEYFTKDYMKEILHIPRL
FT                   IQINQLKSLEDYESQYVNIKGGKRFTTDAPDQYKNIIHCFGSSQTYSFGVEDKYTFSSC
FT                   LQRRVNKNYPDTYLVLNYGVVGYFACHMLKAMDNAQINEGDIIIFYTAIDSEYFFDFAV
FT                   AADITTYNFQPMFQRPHNMGDVFIDTTHINHYGLEKLTEKAFKVMFTYKDILNDFSEIR
FT                   TSKLNEPLNQITSNPEFANYLSYLAEEKIVDFNQKKIGSVVMNCNPFTLGHQYLIQFAS
FT                   ESVDYLYIFLVEEDRSVFSFEDRYNMVKAGISKFDNVKLLRSGNFIISSITFPEYFTKE
FT                   TNKDVIIDPSLDLDIFGNCIAKALNISVRFAGEEPFDPITKQYNRFMENLLKKYDIKFV
FT                   EIKRKEYLDSPISASRVRKLLKEGNLEEMKKIVPKTTYDYLLNCWKGLDSCHR"
     atgaatcatt tttactatta tgagttgtgt gaaattttga gttttgttgc cgcaggtaaa        60
     cttgccgttc ttaacagtat cgaagaagaa tcagaaaatt atattcaatt ttttcgaaaa       120
     aaccatattg atgttatcaa caatgagaac aatcaaattc aggaaaaaga tttgttcttc       180
     atatatacta tatacagtga aaatggggtt aacaaaatta ttgattccgg ttgtgagttt       240
     atactcccaa tcatggaata ctctggtcaa ttacctatgc aatctttaaa agaaagagtt       300
     gcaaaattac aaggtcattt tcaaaacaga acagggaaat tgatcctttt atcagatcaa       360
     aaaacctgtg atttatttga ggaactaaat tttatccctg atttttttat aaatacatcg       420
     ggttttattg agagcaatac tgaacgggta aacccaaaac ccggtgtacc gagaaatgca       480
     tttttcctta tttatacctc agttgaacta ggtcagcttt ttgaaaaatt aaaatattac       540
     caagcatttt attttgctaa tgatgaaaaa gttcatttgc cgacagttta tctgatcaat       600
     aagatcggca agcttaaacg tgataaaaac gtgaaagtat attattttaa cccacctgtt       660
     cttgctgcgg taaaacaccc atccgagaat gagaagatga ttatggatgc attttctaag       720
     tgtactttat atgagtttat tggcatgcta attgaaggta agtttcatga ttctttagtt       780
     aatcataagt tagaatattt tactaaagat tacatgaaag agatattgca tataccgaga       840
     ttgattcaga taaatcaact aaagtctttg gaggattatg aaagtcaata tgtgaatatt       900
     aaaggcggaa aaaggttcac tacagacgct cccgatcaat ataaaaacat cattcattgc       960
     tttggctcca gccagactta tagtttcggt gtggaggata agtatacgtt ttcttcctgc      1020
     ctgcaaaggc gggtaaacaa aaattatccg gatacatatc tggtccttaa ctatggagtt      1080
     gttggatatt ttgcctgtca tatgctcaaa gccatggata atgctcagat taatgaggga      1140
     gacataatca ttttttatac ggctattgac tctgaatatt tttttgattt tgctgttgct      1200
     gccgatatta ctacctataa ttttcagcct atgtttcaaa gaccacataa tatgggtgat      1260
     gtgtttattg acacaaccca tatcaatcat tatggccttg aaaaactgac agaaaaagct      1320
     tttaaggtaa tgttcacata caaagatatt ttaaatgatt ttagtgaaat cagaacaagt      1380
     aaattgaatg agccgctcaa ccaaatcacc agcaatcctg agtttgcaaa ttatttatcc      1440
     tatctggcag aagaaaaaat tgttgatttc aaccaaaaga agattggctc agtagtcatg      1500
     aactgcaatc cttttacctt gggacatcaa tacttgatac aatttgcttc ggagtcggtg      1560
     gattatcttt atatttttct tgtagaggaa gatagatcgg tgttctcatt tgaagataga      1620
     tataatatgg taaaagcggg aataagcaaa tttgataatg ttaaactact cagaagcggt      1680
     aatttcatta tttccagtat cacttttccg gaatacttca ccaaagaaac taataaggat      1740
     gtaatcattg atccatcatt ggacttggat attttcggta attgcattgc aaaagcactc      1800
     aatatatcag tacgatttgc aggtgaagaa ccatttgacc caataacaaa gcagtacaac      1860
     cgtttcatgg agaatttact aaagaaatac gatattaaat tcgtagaaat aaaacgcaag      1920
     gaatatttag atagtcccat cagtgcttcg agagtaagaa agctattaaa agaaggaaac      1980
     ttagaggaaa tgaagaaaat agtacctaag acaacctatg attatttgct caattgttgg      2040
     aagggtttag attcttgtca ccgttaa                                          2067
//

If you have problems or comments...

PBIL Back to PBIL home page