(data stored in ACNUC7421 zone)

EMBL: CP001720.PE406

CP001720.PE406       Location/Qualifiers
FT   CDS_pept        455970..456515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0440"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; Sigma-70
FT                   region 4 type 2; KEGG: bar:GBAA1753 RNA polymerase factor
FT                   sigma-70"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61371"
FT                   /db_xref="GOA:C8W519"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C8W519"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACV61371.1"
FT                   /translation="MNFSESELISEIKKRNLNAYESLIKEYTKPVYYLTYNILNIGNSK
FT                   EDIEECVADVFLEVWLKINGFDSERSNFKTWVLIITKYKALTYKRKLKKNHVENIDDYQ
FT                   LEESDTVERQIIDRETQKKLLEIINSFNKTDKELFIRRYFYNEKISDIMQSLGLSRSAL
FT                   DNRLLRGRKIIKEVLSYD"
     atgaactttt cagagagtga acttatatct gaaataaaga agcgaaactt gaacgcttat        60
     gaatccttaa tcaaagagta caccaagccc gtttattatt taacctataa cattttaaac       120
     atcggcaaca gtaaagagga catcgaagag tgcgtagccg acgtcttttt ggaggtttgg       180
     ctaaaaatca atggatttga cagcgagaga agcaatttca aaacctgggt tttaattatc       240
     acaaaatata aagctcttac atataagcgc aaacttaaaa aaaatcatgt tgaaaacatt       300
     gatgattacc agcttgagga gtccgatacc gttgaaagac agatcatcga tagagaaaca       360
     cagaaaaaac tgctggaaat aatcaatagc tttaataaaa cggacaagga actttttatc       420
     cgcaggtatt tttacaacga gaaaattagc gatattatgc aatctttggg gttgagccgt       480
     tcggcgctgg acaacaggct cttaagaggc agaaaaataa tcaaggaggt tttatcctat       540
     gactga                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page