(data stored in ACNUC7421 zone)

EMBL: CP001720.PE407

CP001720.PE407       Location/Qualifiers
FT   CDS_pept        456508..457824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0441"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61372"
FT                   /db_xref="GOA:C8W520"
FT                   /db_xref="UniProtKB/TrEMBL:C8W520"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61372.1"
FT                   /translation="MTEKQIQTLMQNLDNDLLAKELDDLTNGLEIDLDSITKKAFTKLN
FT                   KRRLKMKRKRIYPLVAASLIAVIGISNAYAAEISDFVGSFFNQRAIYSTVVDGSAYYLE
FT                   SPLQLDKESKLENVIFTKDKLEMSLTLTLTEDKPPEISVATANGKIYKPGGYGYDNNRL
FT                   QLSFWNEAGHNYVFSPTKELKLNIGEKSYSIHLAEGAPVVGSGEIKPAEQTDIGWINVG
FT                   YKKIDQGVQILTSFTDKDLKLVGIGEPVQKTVTRMFKNEKGIITSGTSSMTKPLLGYDK
FT                   DKNIYTYNRAKNAVGRPVIQFESQAPADKEIELKIPGLLVGYEKDFGNFDVAIPGLNEE
FT                   KRIDREIDLKLQKIILQSIKRTSATTAELKFALNTGDTAKVAVQEVSLYSKDVQSGDSV
FT                   WQGDICTMRISFAEKLKNAEFNVSWPRFVVNGDWTLRIK"
     atgactgaaa agcaaattca gacgctaatg caaaatcttg ataatgattt gctggccaag        60
     gaactggatg atttaacgaa cggcttggaa atcgatttgg actctattac caaaaaagca       120
     ttcactaaac tgaataagag gaggttaaaa atgaaaagaa aaagaatata tccccttgtg       180
     gcagcgtctt taattgcggt tatcggtata tccaacgcct atgccgcgga gatttcggat       240
     tttgtcggat ctttcttcaa tcaaagagca atctattcaa ctgttgtaga cggaagcgcc       300
     tactatctgg aatccccctt gcaattggat aaagaaagca aactggaaaa tgttattttt       360
     acaaaggaca agttggagat gagtttaact cttactttaa cagaggataa acctcctgaa       420
     atatcagttg ctacagcaaa cggcaaaatt tataaaccgg gtggttacgg ttacgacaat       480
     aatcggctgc aactcagctt ttggaatgaa gcggggcata attacgtatt ctcgccaacg       540
     aaagaattga aattgaatat tggagaaaaa agttatagta ttcatttagc ggaaggtgca       600
     cctgtagttg gcagcggtga aattaaacct gctgaacaaa cggatattgg gtggataaat       660
     gttggttata agaaaatcga tcagggtgtg cagattttaa ctagttttac cgacaaagat       720
     ttgaaactgg taggtattgg tgaaccggtt caaaaaactg tgacacgaat gtttaaaaat       780
     gaaaagggta tcataaccag cggaacttcc tcaatgacca agcccctcct tggttatgat       840
     aaagataaaa atatttatac ctacaaccgg gctaaaaatg ccgtcggcag gcccgtcatt       900
     caatttgaat cccaagctcc tgccgataaa gaaattgaac tgaaaatacc aggtctgctt       960
     gttggttatg aaaaggattt cggtaatttt gatgtggcaa ttccagggtt gaacgaagaa      1020
     aaaagaattg accgggaaat cgacttgaaa ttgcaaaaaa tcattttgca aagtattaaa      1080
     agaacctccg caacaacagc cgagttaaaa tttgcgttga acacgggaga cactgcaaag      1140
     gttgccgttc aagaggtcag cctttacagt aaggatgtgc aaagcggaga cagcgtttgg      1200
     caaggcgaca tttgtacaat gcgtatcagt tttgctgaaa aattaaaaaa tgctgagttt      1260
     aacgtgagct ggccgcgctt tgtggtaaac ggtgattgga ctctgagaat taaataa         1317
//

If you have problems or comments...

PBIL Back to PBIL home page