(data stored in ACNUC7421 zone)

EMBL: CP001720.PE411

CP001720.PE411       Location/Qualifiers
FT   CDS_pept        460841..461854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0445"
FT                   /product="cell shape determining protein, MreB/Mrl family"
FT                   /note="TIGRFAM: cell shape determining protein, MreB/Mrl
FT                   family; PFAM: cell shape determining protein MreB/Mrl;
FT                   KEGG: afw:Anae109_0117 cell shape determining protein MreB"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61376"
FT                   /db_xref="GOA:C8W524"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:C8W524"
FT                   /inference="protein motif:TFAM:TIGR00904"
FT                   /protein_id="ACV61376.1"
FT                   /translation="MSIGIFSKDIGIDLGNANLLVYVKDEGIVLNEPSVVVIEKNANKI
FT                   LAAGYNAKMMIGRTPKNIVAIRPLKGGVINDFNATQAMIKLFIKKALPKFSMFKPRVVV
FT                   SVPMGVTTVEGQAVRQAVLQAGVREAYLVEEPMAAAIGSGLPVHEPIGNMIIDIGSGIT
FT                   EVAVISMGGIVTSNSIRIAGDDMDEAIIHHIKKEHNLLIGERTAEQIKINIGIAYPLED
FT                   TKAIKIKGRDLQTGLPREENITSKEIYQALSEPLASISAAIISTLEQTPPDFSVDIINN
FT                   GIVLVGGGAMLRGIDHLIHMQTGISVYVVNQPLLAVANGSGKILENINVLRKTLLN"
     atgtcaattg gcatattttc aaaagatata ggaatagatt tggggaatgc taacttactc        60
     gtatatgtga aggatgaagg cattgtttta aacgaaccgt cagtagttgt aattgaaaaa       120
     aatgcaaata aaatattggc tgcaggatat aatgcaaaaa tgatgattgg gcgaactccg       180
     aaaaatatcg tagcaatccg accattaaaa ggtggagtaa ttaatgattt taatgctact       240
     caagctatga taaagctatt tattaaaaaa gcattaccta aattttccat gtttaagcct       300
     agagttgtag tttctgtacc tatgggtgtt acaactgtag aaggacaggc agttcgccaa       360
     gcagtcctgc aggccggggt tcgagaagct tatctagtgg aagaaccgat ggcagccgct       420
     attggttcag gtcttccggt gcatgaacct attggaaata tgattataga tattggcagc       480
     ggaatcacag aagtagctgt aatatccatg ggcggcattg taactagcaa ttctattcgt       540
     atagcagggg atgatatgga tgaagccatt attcatcata ttaaaaaaga acataatctg       600
     ctaattggag agcgaacagc tgaacaaatt aaaattaata ttggaatagc ttacccttta       660
     gaagatacaa aagcgataaa gataaagggt agagatttgc agaccggtct gcctagagaa       720
     gaaaatatta catctaaaga aatttatcag gctttatctg aacccttggc aagcattagt       780
     gctgccatca tatctaccct ggaacaaact cctcctgatt tttccgtgga tattattaat       840
     aacggaattg ttttggtcgg cgggggagca atgcttagag ggatcgatca tctgatacat       900
     atgcaaaccg gtatatcagt atatgtagtt aaccagccat tgcttgcagt agcgaatggc       960
     tctggaaaaa ttttggaaaa tattaatgtg ttgcgcaaga ctttgctaaa ttaa            1014
//

If you have problems or comments...

PBIL Back to PBIL home page