(data stored in ACNUC7421 zone)

EMBL: CP001720.PE412

CP001720.PE412       Location/Qualifiers
FT   CDS_pept        complement(462393..463187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0446"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: vvu:VV1_0837 ABC-type oligopeptide transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61377"
FT                   /db_xref="GOA:C8W525"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W525"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACV61377.1"
FT                   /translation="MLIEVKNLVKEYTGGLFYKRTVKAVNGVSFSIKQGETLGLVGESG
FT                   CGKSTVARLLLMLIRPTSASIRFENTELTVKSPAELQKLRKEMQIIFQHPQQSLYPRRK
FT                   IYEAMAEPLRIHKLIKRKEEEKEKILQLLNDVGLLKEHLERYPHELSGGQAQRVAIARV
FT                   LALKPKFIVADEPTSMLDISVQAQILELMKKLQREHNIGMLFISHDLEVARAVSNRIAV
FT                   MHQGRLVEIGDSEQVFMKPQHPYTKYLTDTTLKLEEKQRFMG"
     atgctcatag aagttaaaaa cctggttaaa gagtatacag gaggactgtt ttataaaaga        60
     acagttaagg ctgtaaacgg agtaagtttt tcaatcaaac aaggggaaac cctgggactg       120
     gtgggagaaa gcggttgtgg aaagtctacg gtagcccggc ttttgctcat gcttataagg       180
     ccgacctctg ccagtatccg gtttgaaaat actgagttga cggtcaaatc accggcagag       240
     ctgcaaaagc taagaaagga aatgcaaata atattccagc atccccagca atccttgtat       300
     ccccggcgaa aaatctatga agcaatggca gagccgctga gaatccataa acttataaag       360
     agaaaagaag aagaaaagga aaagatactc caattattga atgatgtcgg tcttttaaag       420
     gaacacctgg aacgttatcc ccacgaactc agcgggggac aagctcagcg tgtcgctatt       480
     gccagggtgc ttgccttgaa acctaaattt attgtagccg acgaaccaac ttcaatgctg       540
     gatatctcgg tacaggctca aatcctggaa ttaatgaaaa aactccagcg ggagcataac       600
     atcgggatgc tatttatttc tcatgacctg gaagtagcaa gggccgtcag caacaggatt       660
     gctgtgatgc atcaaggccg tttggtggag attggcgaca gtgaacaggt ttttatgaaa       720
     ccacaacacc cttacactaa atatttgact gatactactc taaaattaga agaaaagcag       780
     cgatttatgg gataa                                                        795
//

If you have problems or comments...

PBIL Back to PBIL home page