(data stored in ACNUC7421 zone)

EMBL: CP001720.PE413

CP001720.PE413       Location/Qualifiers
FT   CDS_pept        complement(463171..464178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0447"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: dde:Dde_1182 oligopeptide/dipeptide ABC
FT                   transporter, ATP-binding protein-like; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
FT                   transporter domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61378"
FT                   /db_xref="GOA:C8W526"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C8W526"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACV61378.1"
FT                   /translation="MTDFLAFSDTDSFRHKHAVTEPLLSIVDLKAFFKIKDTVLKALDN
FT                   VSININHHEVVALVGETGCGKSVLVLSILGLLPKNACTEGSIRYLGKEILGIDEEELRG
FT                   LRGKAIGMIPQNPATSLNPLMKIGIQVMEIIRLHKKCNKSAAKHETINLFSRLRLPDPT
FT                   TSICCYPHQLSGGMRQRVLISMGIACNPGLILVDEPTKGLDAVLRKRVVDLLKEQVSSS
FT                   TSSMLLITHDFSVAAALADRVAVMYAGEIVETGPVSQILNHSRHPYTKSLLNSLPGRGF
FT                   NSIPGFSPSLTNLPPGCKFQPRCKTSSSRCAAHHPDMEEILTNHFVRCFHAHRS"
     atgacagatt ttcttgcttt ttcagataca gacagtttcc ggcataaaca tgcggtgact        60
     gaaccgctcc tttccattgt tgatctgaaa gcctttttca agattaaaga tacagtatta       120
     aaagcattag ataatgtctc aatcaatatt aatcatcatg aagttgttgc cctggtagga       180
     gaaacaggtt gcggcaaatc tgttctggtg ctgagtattc ttggtttgtt acctaaaaat       240
     gcctgcacgg aaggaagtat ccgctacctg ggaaaagaaa ttctggggat cgatgaggaa       300
     gaattaagag gactccgggg aaaggcaatt ggcatgattc cgcaaaatcc tgccacttca       360
     ctaaatccac tgatgaaaat tggcattcag gttatggaaa tcattaggtt gcataaaaaa       420
     tgcaacaaat cagcagcaaa acatgaaaca ataaatctgt ttagccggct gcgtttgcct       480
     gatcccacaa caagcatttg ctgctatcct catcagttaa gcggaggaat gagacagcgg       540
     gtactgatat ccatgggaat agcatgcaat cccggcttga ttctggttga tgagcctact       600
     aaagggcttg atgctgtgct gagaaaaaga gtagtggatt tgcttaaaga acaggtttca       660
     tccagcactt catcaatgct gcttattacc catgattttt ctgttgcggc agcgctggca       720
     gatcgcgttg ccgttatgta tgccggagaa atagtggaaa ccggaccagt ttcccaaata       780
     ctaaatcatt cccggcatcc ttatacaaaa tcactgctta attctctgcc gggaagaggg       840
     tttaactcta ttcccggctt tagtccgagc cttactaatc tccctccggg atgcaaattc       900
     cagcccagat gcaaaacatc gtcatcccgc tgtgccgctc atcatccgga tatggaagag       960
     attcttacta accattttgt gaggtgcttt catgctcata gaagttaa                   1008
//

If you have problems or comments...

PBIL Back to PBIL home page