(data stored in ACNUC7421 zone)

EMBL: CP001720.PE415

CP001720.PE415       Location/Qualifiers
FT   CDS_pept        complement(465067..466017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0449"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: noc:Noc_2185 ABC
FT                   transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61380"
FT                   /db_xref="GOA:C8W528"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C8W528"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACV61380.1"
FT                   /translation="MWQFLFKRLAAAILVVAAASMLTFGILHLTPGDTPVTILKHAFIG
FT                   IEQEPTDSEVTNITNRYKLDEPLDKQYFSWIKEAVRGNLGESYVYRTSVAQIIGLRFPA
FT                   TVLLALVSVALSLLIAIPVGVFSAARRNSVFDHLSRLCALFAVSIPSFWLALLLIIVFS
FT                   LQLDLFSVAGFRQISDVVLPCVTIAAGMSAVTMRMMRSCMLEILNQDYILTAKAKGLHE
FT                   SVVVWRHALRNAFLPVITIVGLQFGHMLGGTVVVETVFAWPGLGKLLIDSILAKDIPMV
FT                   QGIIVLIATSYAVVNLLVDLAYVLMDPRIRYGREV"
     atgtggcaat ttctttttaa gcgtttagct gctgcaattt tagtcgttgc agcagcttcc        60
     atgctaacat tcggaatatt acatctgacg ccgggagata ctcctgtgac tatcctgaag       120
     catgctttta taggaataga acaagagccc acagattcgg aagttaccaa tatcacgaac       180
     cggtacaagt tggatgaacc attggataag cagtattttt cctggataaa agaagctgtc       240
     agagggaacc ttggggaatc ctatgtttac agaacttccg tggctcagat cattgggttg       300
     agatttccgg caacagtcct gctggctctg gtgagtgttg cactttcact gctgatagca       360
     attccggttg gagttttttc tgcggcaaga aggaattctg tgtttgatca cctcagccgg       420
     ttatgtgctc ttttcgctgt gtctatacca agtttttggc tggcgctgtt attaatcatt       480
     gttttttccc ttcaattaga cctgttttcg gtagcaggat tcaggcaaat atctgatgtg       540
     gtgctgccat gcgtaacaat agcagcaggt atgtcggcgg ttactatgcg catgatgcgt       600
     tcatgcatgc ttgagatatt gaaccaggat tatattttaa cagccaaagc aaaaggtctg       660
     catgaaagcg tggtcgtatg gcggcatgcg ttaaggaacg cttttctccc ggtaataacc       720
     atagttggac ttcaatttgg acatatgctt ggaggaacgg tagtcgtgga gacggtgttt       780
     gcctggccgg ggttaggaaa actgctgatt gattcaatat tagctaaaga tatccctatg       840
     gtccagggca ttatagtctt aatcgccact tcctacgccg tagtcaattt gctggtagac       900
     ctggcttacg tcctgatgga tcccagaata cgctatggaa gggaagtcta a                951
//

If you have problems or comments...

PBIL Back to PBIL home page