(data stored in ACNUC7421 zone)

EMBL: CP001720.PE416

CP001720.PE416       Location/Qualifiers
FT   CDS_pept        complement(466023..467582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0450"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: bha:BH1796 nickel ABC transporter (nickel- binding
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61381"
FT                   /db_xref="GOA:C8W529"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C8W529"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ACV61381.1"
FT                   /translation="MIKRKIMFIVVCILMTISVLLTSGCGVKKENKDSNKKLVVGEMWK
FT                   IDSIDPSTSGTLTTEKAMITETLVGVKENFELKPGLATEWKRIDANTWSIVLRQGVKFH
FT                   DGTPMDGEAVKWSLMRAIAVNPQVQTFTKIKSIEVENDHTLKITTTAPTGDFPASLHYM
FT                   GASVIAPSSVDKAGKLIKPIGTGPFMLEQFEASTGDMEMAKYKDYWGTPAKLEKLEIRP
FT                   LPDPNTRALALEKGEIDFTCDPPYNELERLGKEKGLKVELNPTARTYIVEMNLKKEPFN
FT                   DVRVRKALSYAIDRESITKHVLFGCGTPAKGPFMPGMAWTNENLKGYPYSPGKAKLLLE
FT                   EAGWKDTDGDGIIDKNGQPLKITLMTYPQRPGLPPMAQALQDQFKQAGIDLKIEIMENS
FT                   AMSQVASTGKWDMKMSAFATAMIPTPSYHLQVLYYSENNKLIGYNNAKVDQLIDECVAV
FT                   DDQQKKYELSKQVQQILEDEVPVLPIAYYGVAAVMNSKIENFVFNPTAHDYMLTTEVGI
FT                   KE"
     atgattaaaa ggaaaatcat gtttatcgta gtttgtatac tgatgaccat cagcgtcctt        60
     ctcacatcag gttgtggtgt aaaaaaagaa aataaggaca gtaataaaaa attggtagta       120
     ggagaaatgt ggaaaatcga cagtattgat ccgtcaacta gtggcacttt gacgactgaa       180
     aaagccatga tcacagaaac attggtagga gtaaaggaga attttgagtt aaaacccggt       240
     cttgcaactg aatggaaaag aatagatgca aacacatgga gtattgttct tcgccaaggg       300
     gtcaaattcc atgacggcac accgatggat ggagaagcag tgaaatggtc gctcatgaga       360
     gctattgctg ttaacccgca ggttcaaaca tttacaaaaa taaaatcaat agaagtagag       420
     aacgatcata cattaaaaat tacaacaaca gctccaaccg gcgatttccc tgcttcgctg       480
     cattatatgg gcgcatctgt tatcgcgcca agctcggttg ataaagccgg caaacttatc       540
     aaacctatcg gtacgggacc ttttatgtta gaacaatttg aagcatcaac aggcgacatg       600
     gagatggcaa agtataagga ctactgggga actcccgcca agctggaaaa attggaaata       660
     cgtcctttgc cggatcccaa tacccgtgct ctggccttgg aaaaagggga aatagatttt       720
     acctgtgatc caccttataa tgaactggag agattgggca aggagaaagg acttaaagtc       780
     gaactcaatc ctaccgccag gacatatatt gtggaaatga acctgaaaaa agaaccgttc       840
     aacgatgtaa gagtcagaaa agctttgagc tatgctattg acagggaaag tattactaaa       900
     catgtgcttt tcggatgcgg aactcctgcc aaggggccat tcatgccggg aatggcgtgg       960
     acaaacgaaa atttaaaagg ttatccctat tctcccggca aggcaaaatt actattggaa      1020
     gaagcgggtt ggaaagatac tgatggagac ggaatcatag ataaaaacgg ccaaccgctg      1080
     aaaataaccc ttatgactta tccgcagaga ccgggccttc ctccaatggc tcaagcttta      1140
     caggatcaat tcaaacaagc agggattgat ttgaagattg agattatgga aaattccgcc      1200
     atgagccaag ttgcttcaac aggcaaatgg gatatgaaaa tgagtgcttt tgcgaccgct      1260
     atgattccta ctcccagcta tcatttacaa gtactgtatt attctgaaaa caacaaatta      1320
     attggctaca ataatgcaaa agttgaccaa ttgatcgatg aatgtgttgc tgtagatgac      1380
     cagcagaaaa agtatgagct ttccaaacag gtacagcaaa ttctggaaga tgaagtgcct      1440
     gtactaccaa ttgcctatta cggtgtggcc gctgtcatga acagcaaaat cgagaacttt      1500
     gtatttaatc ctacagctca tgattacatg cttacaacag aagtggggat taaggagtag      1560
//

If you have problems or comments...

PBIL Back to PBIL home page