(data stored in ACNUC7421 zone)

EMBL: CP001720.PE417

CP001720.PE417       Location/Qualifiers
FT   CDS_pept        complement(467918..468610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0451"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: net:Neut_1733 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61382"
FT                   /db_xref="GOA:C8W530"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C8W530"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACV61382.1"
FT                   /translation="MMQQDRLYDIWWQNLEEGEQQMEERHLRGWKEVINLIQEQDLSDM
FT                   TVLDFGCNQGGFLRHLYQVKPFKEGMGIDLAQQSIAVANSRKGDLPLTYVATNTPEQYT
FT                   NKFNLAVSQAVIYLIKDLKSHAWKIKQMLKPGGVYYATYTDLNDNPSLQHFTIWINENS
FT                   LVESNAHTLDFIAETFASEGFNVEIQRRHPQGFIDVSRKKDGFLRIADRMKATYEQAYI
FT                   FRFVLTDK"
     atgatgcagc aagacaggct ttatgacata tggtggcaaa atctcgaaga aggcgagcag        60
     caaatggaag aaagacatct aagaggctgg aaagaagtca tcaatttaat tcaggagcag       120
     gatctgtctg atatgacagt gcttgacttt ggctgtaatc agggaggatt tttgcgccat       180
     ttatatcaag tcaaaccctt taaagagggt atgggtattg atctggcaca gcagtcaata       240
     gctgtcgcta attctcgtaa aggtgatttg ccgcttactt atgttgcaac aaatactccg       300
     gagcagtaca ccaacaaatt taaccttgct gtaagtcagg ctgtaattta tttaattaaa       360
     gacctaaaaa gccacgcctg gaagattaag cagatgttaa aacccggtgg agtgtattat       420
     gccacttaca ctgatttaaa tgacaatccc agtctgcagc attttaccat atggattaat       480
     gaaaacagtc tggtagagtc caatgcccat acactggact ttattgccga aaccttcgca       540
     tcagagggtt tcaacgtgga aattcaacgt cgccatcctc aaggttttat cgatgtttcc       600
     cgcaaaaaag acggcttttt acgcattgct gatagaatga aagccaccta tgagcaggca       660
     tacatatttc gcttcgtgct gactgataaa taa                                    693
//

If you have problems or comments...

PBIL Back to PBIL home page