(data stored in ACNUC7421 zone)

EMBL: CP001720.PE418

CP001720.PE418       Location/Qualifiers
FT   CDS_pept        468993..469412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0452"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: dps:DP1497 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61383"
FT                   /db_xref="GOA:C8W531"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C8W531"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACV61383.1"
FT                   /translation="MKAIEELTDELLLFFNGFASWESSVIRSSDLTVSEAHAIEVLGQY
FT                   GKMNMKNLAQKLGVTTGTTTVTVDRLEKKDYAKRETTREDRRVNLISLTEKGMRAFAEH
FT                   HNFHLNLTEQMVSNLSEEEIEQFHKILKKINAETF"
     atgaaagcta ttgaagaact aaccgatgag cttttacttt tttttaacgg ttttgcctca        60
     tgggaaagct cggtaattcg ttccagtgac ttgactgttt ctgaggctca tgccattgaa       120
     gtgctggggc agtatggaaa gatgaatatg aagaacttgg cccaaaaatt aggcgtaacc       180
     actgggacca caactgttac agtagataga ttggaaaaaa aggattatgc caaacgtgaa       240
     acaactaggg aagacaggcg ggtcaatctg atcagtttga cggagaaggg aatgagagcc       300
     tttgcagaac atcacaattt ccaccttaat ttaacagagc aaatggtatc caacctgtct       360
     gaagaagaaa ttgagcagtt tcacaaaatt cttaaaaaaa taaatgccga gactttttaa       420
//

If you have problems or comments...

PBIL Back to PBIL home page