(data stored in ACNUC7421 zone)

EMBL: CP001720.PE42

CP001720.PE42        Location/Qualifiers
FT   CDS_pept        45177..46634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0044"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="TIGRFAM: transposase, IS605 OrfB family; KEGG:
FT                   bar:GBAA1783 IS605 family transposase OrfB"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61007"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVD7"
FT                   /inference="protein motif:TFAM:TIGR01766"
FT                   /protein_id="ACV61007.1"
FT                   /translation="MKTTAMGIIPEPTPKQKEYIDNLMDRYCAAVRWAFKRLLDGWKVQ
FT                   DIRITVQGKFRLNSRQANDAVYDAQTTIKSQYELVQMHYENAKAKVEFTEKRIAKAKSP
FT                   AKIAKLQKRLEKEQRKLAFWQNHLDNNTFPPVVFGGKKLFQERCKGNITREEWQEVRSN
FT                   RYLSRGDKTKGGNLNTRIYEGQDQIYLDIAADPVRKGKSVRYNRITVPIYLAQKPSKKT
FT                   NKINGINYRQMVLDYLKTGSAYQVEILRRDGKYYVHVSIEEEVPMPYNHKGAFGVDTNP
FT                   DGLGVTQVDCLGQYRGSEWLGQGEWTYARTNRRNNQTCEMAKKVILQAKEKGYALAVED
FT                   LKFKNDKSVTAKFNRMSHSFVWSKFLKAVDRSAAREGVPILKVKPAFTSVIGILKYQHM
FT                   YGIAVHEAAGYVIARRGLGFDHEKIPKILLDKLIKKKPEFKQMANWKQWSAVKKSVLAK
FT                   IKKITKRKKVNSLVSWQIHRKNVLGIG"
     gtgaagacaa cggcgatggg gataatcccg gaaccgacac ctaaacagaa agaatacatt        60
     gataacctca tggatcgtta ctgtgccgca gttcgttggg catttaaaag actgctggac       120
     ggatggaaag tacaggacat tcgtataact gtacaaggaa agttcagact taactcccgg       180
     caggctaacg atgcagtata tgatgcccag accacaatca aaagccaata tgaattagtg       240
     cagatgcact atgaaaacgc caaagcaaag gttgaattta cagaaaagcg tatcgccaag       300
     gctaaatcac cggctaagat tgccaaactg caaaaacggt tagaaaagga acagcgtaaa       360
     ctggccttct ggcaaaatca cctggataac aatacttttc cgcctgttgt attcggagga       420
     aagaagctct ttcaagaacg ctgcaaaggc aatattacca gagaagagtg gcaggaagtc       480
     agaagtaacc gttatctgtc acggggagat aaaaccaaag gcggcaacct aaatacccgc       540
     atatacgaag gccaagacca aatctatctt gatatagccg ccgacccggt acggaaaggg       600
     aaatccgttc ggtataaccg cataacggtg ccgatctatt tagctcaaaa gccatcgaaa       660
     aagaccaaca aaattaacgg tatcaactac cggcaaatgg ttttggatta tcttaaaaca       720
     ggcagtgcct atcaggtaga aatcctccgc agagacggta aatattacgt ccatgtgagt       780
     attgaagaag aagttccgat gccatataat cataagggcg cgtttggtgt agacaccaac       840
     ccggacggat taggcgtaac ccaggtagac tgtctggggc aataccgggg cagtgaatgg       900
     cttggtcaag gtgaatggac ttatgccaga acaaaccgga gaaataacca gacctgcgaa       960
     atggctaaga aagtgatcct ccaggctaaa gaaaaaggtt atgccctggc ggtagaggac      1020
     ttgaagttta aaaatgacaa gtccgtaacg gccaagttta accgaatgag tcacagtttt      1080
     gtctggtcga agtttctaaa agcagttgac cggagtgctg cccgtgaggg agtgccgata      1140
     ttaaaggtaa aaccggcttt tacttcagtc ataggcatcc taaaatacca gcacatgtac      1200
     ggcatagctg ttcacgaagc ggcaggctat gtcatagccc ggcgtggctt gggctttgat      1260
     catgagaaga tacccaagat attgcttgat aaactgatta aaaagaaacc tgaatttaaa      1320
     caaatggcaa attggaaaca atggtcagca gttaaaaagt ctgtgctggc caagattaaa      1380
     aaaatcacga aaaggaagaa ggtgaatagc ctggtttcat ggcagattca ccggaaaaat      1440
     gtgttaggta taggttaa                                                    1458
//

If you have problems or comments...

PBIL Back to PBIL home page