(data stored in ACNUC7421 zone)

EMBL: CP001720.PE420

CP001720.PE420       Location/Qualifiers
FT   CDS_pept        471725..473068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0454"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: asu:Asuc_1537 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61385"
FT                   /db_xref="InterPro:IPR025420"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041682"
FT                   /db_xref="UniProtKB/TrEMBL:C8W533"
FT                   /inference="similar to AA sequence:KEGG:Asuc_1537"
FT                   /protein_id="ACV61385.1"
FT                   /translation="MERLVMQKLLDWKNSKYRKPLILKGVRQVGKTWLLKEFAKRRYGN
FT                   MAYFNFDENPEYKQFFESTKDVERILQNLMMASGEVIKRDSPEDTLIVFDEIQECPNAL
FT                   NTLKYFCENTPHYHVACAGSLLGIALSKPASFPVGKVDFLEIMPMTFTEFLMANGDGNF
FT                   AAYMDSVDRIEPIPEAFFNPLYEKLKMYFVTGGMPESVRSWTQDRNVELMQQVLSNILG
FT                   AYERDFAKHPDPKDFPKISLIWKSIPSQLARENKKFIYKVVKEGARAREYEDALQWLCD
FT                   ANLTYKIYRSTAPGLPISAYDDLSAFKLYMADVGLLRRLSLLAPSAFGEGNRLFVEFKG
FT                   ALSENYVLQALQNQFEVMPRYWTMDNPRYEVDFLIQRENEILPVEVKSESNVESRSLKK
FT                   YKEKYEDKVKLRVRFSLNNPRLDDDLLNIPLFMADHADRIIGMALERI"
     atggaaagac tggttatgca aaagctgctg gactggaaaa actccaaata tcgaaaaccc        60
     cttattttaa aaggggtacg tcaggtcggt aaaacttggc ttctcaagga attcgcaaaa       120
     cgccgctatg gaaacatggc ttatttcaac tttgatgaga acccggagta taaacagttt       180
     tttgagagca ccaaggatgt ggagcgtatt ctgcaaaacc tgatgatggc aagcggtgag       240
     gtcattaaac gagacagccc ggaggacacg ctcattgttt ttgacgagat acaggaatgt       300
     cccaacgctt tgaacacgct gaaatatttc tgtgaaaaca cgccccatta tcatgtggct       360
     tgtgcaggat cgttattggg cattgctctt tccaaacctg cttcttttcc ggttggcaag       420
     gtggattttt tggaaatcat gccaatgacc tttacggaat ttttaatggc caatggcgac       480
     ggaaacttcg ccgcttacat ggacagcgta gatagaatcg agccaattcc ggaggctttt       540
     ttcaatccac tatatgagaa gcttaaaatg tattttgtaa caggcggtat gccggaatct       600
     gttcgctcct ggacgcaaga ccggaatgta gagctgatgc agcaggttct gtctaatatt       660
     ttgggcgcct atgaacgtga ttttgccaag cacccagacc ctaaggactt tccgaaaata       720
     tcgctgatat ggaagtcaat cccttcccaa ctggcaaggg agaataagaa gtttatctat       780
     aaggttgtta aggaaggagc aagggccaga gaatacgagg atgccctgca atggctttgc       840
     gatgcaaacc taacttataa gatataccgc agtaccgcgc cgggtttgcc aatttcggct       900
     tatgacgatt tatctgcctt caagttatat atggcagatg taggactgtt gcgccgctta       960
     tcccttttag ccccttctgc ctttggcgag ggcaatcggc tgtttgtgga atttaaaggt      1020
     gctttaagtg agaattatgt cctgcaggcg ctgcaaaacc agtttgaagt catgccacgc      1080
     tattggacga tggacaatcc gcggtatgaa gttgactttc taatccagag agaaaacgag      1140
     attttaccgg tggaagtaaa atcggagagc aatgtggaaa gccggagcct gaaaaagtac      1200
     aaagaaaaat acgaagataa ggtaaagctt cgtgtccggt tttcattgaa taacccgcgc      1260
     cttgatgatg acctgctgaa tataccgttg tttatggccg atcatgcgga taggattatc      1320
     gggatggctt tggagcggat ttaa                                             1344
//

If you have problems or comments...

PBIL Back to PBIL home page