(data stored in ACNUC7421 zone)

EMBL: CP001720.PE421

CP001720.PE421       Location/Qualifiers
FT   CDS_pept        473109..473222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0455"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61386"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVL3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61386.1"
FT                   /translation="MNGGLVLCTNKMFAKASMMWQNIIRRNNERLIIIEQT"
     atgaatggcg gccttgtttt gtgtactaat aaaatgtttg ccaaagcctc tatgatgtgg        60
     caaaatataa tcagacgcaa taacgaaagg ctgattatta ttgagcaaac ttga             114
//

If you have problems or comments...

PBIL Back to PBIL home page