(data stored in ACNUC7421 zone)

EMBL: CP001720.PE423

CP001720.PE423       Location/Qualifiers
FT   CDS_pept        473619..474710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0457"
FT                   /product="transposase, IS605 OrfB family"
FT                   /note="TIGRFAM: transposase, IS605 OrfB family; PFAM:
FT                   putative transposase IS891/IS1136/IS1341 family;
FT                   transposase IS605 OrfB; KEGG: noc:Noc_0388
FT                   IS891/IS1136/IS1341 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61388"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:C8W536"
FT                   /inference="protein motif:TFAM:TIGR01766"
FT                   /protein_id="ACV61388.1"
FT                   /translation="MQIVYRFEMRPTKEQQKKMFHTLKLCRKLYNWSLSERQRVYKETG
FT                   QGLTYNKQQNMLPGYTKEHLEYKQVHSQVMQDTLRRVDFAYQRFFAKEAGYPRFKNRDH
FT                   YTSFTYPQVDAVKKTFSKPGKIYLSKIGFVKMTTHREFDASQISRVNIKYHGGKWYANL
FT                   TAEVEVLENLIDSTKSIGIDVGLEHFAVLSDSTEIGTPKYYRKSERKLAKQQRRLSRKK
FT                   KGSNNRGKAKTKVAKLHAKITNQRKDFLHKASLDVVQSHDIVFMEDLKSKNMVKNHYLA
FT                   KSIHDASWGTFRNFVEYKCHRYGKIFLPVPPHGTSQTCLCGANVPKDLSVRVHRCPACG
FT                   MVMPRDLVSAILIERRGLEMLAA"
     ttgcaaattg tctaccggtt tgaaatgcgt ccgaccaaag agcaacagaa aaaaatgttt        60
     cacacactaa aactttgccg gaaactctat aactggtctt tatctgagcg tcagcgtgtg       120
     tataaagaaa ccggccaagg gttgacatat aataaacagc agaatatgct gccgggctat       180
     acaaaagaac atctggaata caagcaagtt cacagtcagg taatgcagga tactttgcgc       240
     cgggtagact ttgcctatca gcggtttttt gccaaagaag ccggataccc ccggttcaaa       300
     aaccgtgacc attacacatc atttacctat ccccaggtgg atgctgtaaa gaaaactttc       360
     tctaagccgg gtaaaatcta tctctctaag attggttttg taaaaatgac aactcaccgg       420
     gaatttgatg ccagtcaaat atccagggtt aacataaagt atcacggtgg taagtggtac       480
     gctaatttga ctgccgaagt ggaagtactc gaaaatctta tcgacagtac caaatccatt       540
     ggaatagacg tgggccttga acattttgct gtattgtctg atagtacaga aataggaacc       600
     ccaaaatact atcgtaaatc agaaaggaag ttagccaaac aacagcgaag actttctcgc       660
     aaaaagaaag gttctaacaa ccgagggaaa gccaaaacta aagtggctaa acttcatgct       720
     aagataacta atcaacgaaa agactttcta cacaaggcca gtctagacgt ggttcagagc       780
     catgatattg tcttcatgga agatctaaag agcaagaaca tggtcaaaaa ccactaccta       840
     gctaaaagca tacatgatgc ttcatggggt acattcagaa actttgttga gtataaatgt       900
     cacagatatg gtaaaatatt tcttcctgtc cctcctcatg gcacttccca gacatgtctt       960
     tgtggtgcca atgtgccaaa ggatttgagt gtcagagtgc accggtgtcc tgcttgtgga      1020
     atggttatgc ccagggattt ggtgtcagcc atattgatag aacgtcgtgg cttagaaatg      1080
     ctagcggctt ag                                                          1092
//

If you have problems or comments...

PBIL Back to PBIL home page