(data stored in ACNUC7421 zone)

EMBL: CP001720.PE428

CP001720.PE428       Location/Qualifiers
FT   CDS_pept        478496..478798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0464"
FT                   /product="regulatory protein MerR"
FT                   /note="PFAM: regulatory protein MerR; KEGG: hpa:HPAG1_0202
FT                   putative transposase OrfA"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61393"
FT                   /db_xref="GOA:C8W541"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:C8W541"
FT                   /inference="protein motif:PFAM:PF00376"
FT                   /protein_id="ACV61393.1"
FT                   /translation="MENHISIGKAAKYLGVSINTLRVWEKKKMLLKAVKETNSALVIIE
FT                   YKDRLARFGYAYLEKYISDFGGHIVVIEKKLSKVIESEVTASEDNGDGDNPGTDS"
     atggaaaacc atataagtat tggcaaagca gctaaatatt taggggttag tattaatact        60
     ttacgtgttt gggaaaagaa aaagatgtta cttaaggctg taaaggagac taatagcgcc       120
     ttagtaatta ttgagtataa agaccgttta gcacggttcg gttatgccta cttagagaaa       180
     tacattagcg actttggcgg gcatattgta gtaatagaaa aaaagctgtc aaaggtcatt       240
     gaaagcgagg tgactgccag tgaagacaac ggcgatgggg ataatcccgg aactgacagc       300
     taa                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page