(data stored in ACNUC7421 zone)

EMBL: CP001720.PE431

CP001720.PE431       Location/Qualifiers
FT   CDS_pept        complement(480600..482414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0467"
FT                   /product="Transposase-like protein"
FT                   /note="KEGG: shn:Shewana3_3655 IS4 family transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61396"
FT                   /db_xref="GOA:C8VZR2"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025457"
FT                   /db_xref="UniProtKB/TrEMBL:C8VZR2"
FT                   /inference="protein motif:COG:COG5421"
FT                   /protein_id="ACV61396.1"
FT                   /translation="MDLQPILEQLAKLPPEILMKIMPELKVEVPKADPSGAVLIGVFLA
FT                   RSLGIGKIIDNFIGEEYVTYEHLREDRANGSKCRVSTGLACEIMVGDMLGRNKDLTRLY
FT                   KFEEACENWQVETILGIPSEKFNDDKMGRALDAINSNAKYMANVLQDIVLSASKKFGVP
FT                   LNTFYNDTSSIPVSGVMEDNDKVQYGYGGLPGLKQLILNLTIASGASLPVTSSIDSGNV
FT                   QGGTTFERSFEKVKEITDDQEFEMIIDRGILTQDNMHLMLTNSNQKAFFIGPLKDELSK
FT                   NWVLEQLNEAKKDDFAAIDYRSKKEIERNLPRHYEALETKYTFKVKLEPPSEGSKNKKQ
FT                   LKKSKRIFATHTIRAVIYCDLNKKPKEQERRQKRITSTEDALVELNGKLNKRNLITKEA
FT                   CEKAVDNIFKGQPEMRRLFNVTIKLNQHNAIVMSWSKDEAIIPELEKTDGIFVLLTNHD
FT                   KEKVDANELLTRYRGRNDIEISFRFLKGSLDLQQVFLRNPERVDAYCFLKVLAMLVLNL
FT                   AAWLLAKNGKKMSPQKLQRELGDLTISEQRLQPIGIHHWNGTNIPNTIDVLVNLFNLPH
FT                   PLELIEVINSAINFSYHIEKWFKDNFRK"
     atggacttac aacctatttt agaacaacta gctaaattac cccccgaaat attgatgaag        60
     ataatgcccg aattaaaagt agaagttccg aaggcagatc cctcaggtgc agtacttatc       120
     ggtgtctttt tagcaagaag cctgggcatc ggtaaaataa ttgacaactt tataggcgaa       180
     gaatatgtta cttatgagca tctacgtgaa gacagagcca acggttctaa atgtcgggta       240
     agtactggtt tggcatgtga aataatggtt ggcgacatgc tgggcagaaa taaagatctc       300
     acccgtttat ataaatttga agaagcttgt gaaaactggc aagtcgaaac aatactcggt       360
     ataccgtccg aaaaatttaa tgatgacaaa atgggtagag cccttgacgc tataaactca       420
     aatgcaaaat atatggctaa tgtattgcag gatattgttt tatcagcatc caagaaattt       480
     ggagttccac ttaacacttt ttacaatgac acatcctcca ttccagtctc tggtgttatg       540
     gaggataacg ataaagttca atacgggtat ggtggtctac cgggtttaaa acaattaatc       600
     cttaatctta cgatagcctc tggtgcatct ttgccggtaa catcatcaat tgattccggt       660
     aatgttcaag gcggtacgac ttttgagcgt tcattcgaga aggttaaaga gattaccgat       720
     gaccaagaat ttgagatgat tattgatcgt ggtatcctaa cccaagataa tatgcatttg       780
     atgcttacta atagcaacca aaaggccttt tttataggtc cactcaagga tgagctatca       840
     aagaattggg tcttagagca attaaatgag gctaaaaaag atgattttgc tgctattgac       900
     tatcgctcta agaaagaaat agaaagaaat ctacccagac actacgaggc gttagagaca       960
     aaatatacgt ttaaggtaaa acttgagcct ccctcagagg gtagtaagaa caaaaagcaa      1020
     ctcaaaaaaa gtaagcgaat atttgcgaca catactataa gggcggttat ttattgtgat      1080
     ttaaacaaaa aacctaagga acaagagcgt cgtcaaaagc gtataaccag cacagaagat      1140
     gcattagtag aactaaatgg taagctcaac aaacgtaact taattacgaa ggaagcctgt      1200
     gaaaaagcag tagataatat ttttaaaggg cagcctgaaa tgcgtaggct gtttaatgta      1260
     acaattaaac taaatcaaca taatgctatt gttatgtcct ggtcaaaaga tgaagctata      1320
     attccagagc ttgagaaaac cgacggtatc tttgtgcttt taaccaacca tgacaaagag      1380
     aaggttgatg ctaatgaact gcttacccgc tatcgtggta ggaacgacat cgaaatcagt      1440
     tttaggtttt tgaagggttc tcttgattta caacaagtat tccttcgcaa tcctgaaaga      1500
     gtagatgcct attgcttttt aaaagtattg gctatgcttg tgcttaattt agcagcctgg      1560
     ctgttagcta aaaatggcaa aaagatgtct ccccaaaaat tacagagaga acttggcgac      1620
     ctaactatct cagaacaaag gttgcagcct attggtatac accattggaa tgggacgaat      1680
     attcctaata ctattgatgt attggttaat ctgtttaact taccacatcc acttgaatta      1740
     atagaggtta ttaattcagc aatcaatttt tcttatcata ttgagaaatg gtttaaggat      1800
     aattttagaa aataa                                                       1815
//

If you have problems or comments...

PBIL Back to PBIL home page