(data stored in ACNUC7421 zone)

EMBL: CP001720.PE433

CP001720.PE433       Location/Qualifiers
FT   CDS_pept        483304..483756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0469"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61398"
FT                   /db_xref="GOA:C8W546"
FT                   /db_xref="UniProtKB/TrEMBL:C8W546"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61398.1"
FT                   /translation="MNNRLYNIIFPIWLMLFNPLIGIPMLFVNYFIDRSIYYLILRNNE
FT                   FYVNNKKSFNTCVNLAFIMGITVDFLGFIFLVLVKGLEYSNYKEWIGLEVIFTIIGCSL
FT                   LIGFLNYHLSLTLKIPKNIAFKIGVCMGIITTPWLFLIPPYYNNFK"
     ttgaataaca gactgtataa tattatattt ccaatatggt tgatgttatt taacccatta        60
     ataggtatac ctatgttatt tgtaaattat tttattgaca ggtcaattta ctacttaata       120
     ttgaggaata atgaatttta tgttaataat aagaaatctt ttaatacttg tgtcaattta       180
     gcttttatta tgggtattac ggtagacttt ttgggtttta tttttttagt attagtcaaa       240
     ggattagagt attctaatta taaagagtgg ataggtttag aagttatatt tacgattatt       300
     ggatgttcac tcttaatagg atttctaaac tatcatttat ctcttacatt aaaaatacca       360
     aagaatatag cttttaagat aggagtatgt atgggaatta taactactcc atggttattt       420
     ctaatacctc catattataa taactttaaa taa                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page