(data stored in ACNUC7421 zone)

EMBL: CP001720.PE436

CP001720.PE436       Location/Qualifiers
FT   CDS_pept        486210..487163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0473"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: ppd:Ppro_1999 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61401"
FT                   /db_xref="GOA:C8W549"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C8W549"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACV61401.1"
FT                   /translation="MQKKEVGPERRFITSPYMLLTLATLFWAGNTVVGKAANLLIPAFS
FT                   LSFWRWVVALFLILPFGVRAVQRDWDFYCKNWKYLMMLAFFSVTAFNTFLYWALNWTTA
FT                   INVSVIFATMPLVIFFLSWMVGGQKAKVNQIIGVLLALIGVLIVISKGNISILMNLNIN
FT                   YGDILVLVSVVCFGIYSILFKKLQADVDQIGLITVFIFFGLIGIAPFYAWDIYQHHFFS
FT                   VDIKMVWILLYVGLFPSLLSFFFWNKAIESGGAHIAGMFFNLVPVFSSVLAVIFLKEIF
FT                   TLSHLIGMVLIFIGIYFSTFYEHRPLEADIQRENRA"
     atgcaaaaaa aagaagttgg gcctgagcgg agattcatta catctccata tatgttgtta        60
     actctcgcca ctctattctg ggccggtaat accgtggtcg gcaaagccgc caatttgctg       120
     ataccggcgt ttagcctgtc gttttggcgg tgggtggtag ccttattcct gatactacca       180
     tttggcgttc gagcggtgca gcgcgactgg gacttttatt gtaaaaattg gaaatacttg       240
     atgatgctag cgttttttag tgtcaccgcc ttcaacactt ttctctactg ggcgctgaat       300
     tggaccaccg ctattaatgt cagcgttatc tttgcaacga tgcctttggt gatttttttt       360
     ctctcgtgga tggtgggtgg gcagaaagcc aaagtcaatc aaatcatagg tgtgctattg       420
     gccctaatcg gtgtattgat cgtcatttcc aaaggtaaca ttagtattct tatgaatttg       480
     aatataaatt acggcgatat acttgttctt gtctcggtgg tatgcttcgg aatctattca       540
     attctattta agaagctcca ggcagatgtt gatcaaatag gactgatcac agtatttatc       600
     ttttttgggc ttattggcat tgctccgttt tatgcctggg atatttatca acaccatttc       660
     ttttctgtag atataaagat ggtatggatt ttactatacg tggggctttt cccatcgttg       720
     ctatctttct tcttctggaa taaggcaatt gaatccggtg gagcacatat tgccggtatg       780
     tttttcaatc tcgtaccggt cttttccagt gtgcttgccg taatatttct taaagagatt       840
     ttcactttgt cccacctgat cggaatggta ttaattttta tcggaatata tttctcaacg       900
     ttttatgaac accgtcctct tgaggctgac attcagcgag aaaaccgagc ctga             954
//

If you have problems or comments...

PBIL Back to PBIL home page