(data stored in ACNUC7421 zone)

EMBL: CP001720.PE437

CP001720.PE437       Location/Qualifiers
FT   CDS_pept        487821..488018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0474"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61402"
FT                   /db_xref="UniProtKB/TrEMBL:C8W550"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61402.1"
FT                   /translation="MDIACNGPGGYRRFHKMEGGDGQITFQGKSPGRYLLLARRKLQEG
FT                   EEEVYDELSLTSTFAIMIKK"
     gtggacatag cttgcaatgg gccaggtgga tatcgccggt tccataaaat ggagggcgga        60
     gacggtcaaa ttactttcca gggaaaatca ccgggacgct acttgctgct cgctcgccgc       120
     aaattacagg aaggtgagga agaagtatat gatgagcttt cattaacctc tacttttgcg       180
     attatgatta aaaaataa                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page