(data stored in ACNUC7421 zone)

EMBL: CP001720.PE439

CP001720.PE439       Location/Qualifiers
FT   CDS_pept        489003..489128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0476"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61404"
FT                   /db_xref="UniProtKB/TrEMBL:C8W552"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61404.1"
FT                   /translation="MDINSGVKDTIFKYVQEQGEDGILRQKNRYCLGIITRWADK"
     atggatatta attcaggagt taaggatact attttcaaat atgtacagga acagggtgag        60
     gatggtatcc tgcggcagaa aaacaggtat tgtctgggta ttataacccg gtgggcggat       120
     aaatga                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page