(data stored in ACNUC7421 zone)

EMBL: CP001720.PE441

CP001720.PE441       Location/Qualifiers
FT   CDS_pept        491477..492658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0479"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: Tetratricopeptide TPR_2 repeat protein; TPR
FT                   repeat-containing protein; SMART: Tetratricopeptide domain
FT                   protein; KEGG: TPR domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61406"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C8W554"
FT                   /inference="protein motif:PFAM:PF07719"
FT                   /protein_id="ACV61406.1"
FT                   /translation="MCIPISVLTREFEGETLYNQGLSYFKKGSPFSQEGIIALNEAKAI
FT                   FNRAIDLEPELADVYYMRGVTTLQFVHFYNRPFNKEQEGMFEEALKDFDKALQINEDYS
FT                   IAYAGFGNAYDRYGSFDEAIGWYNKALEREAEIKSKWGESSLSEIYFSRGRAYHRTLKH
FT                   CCIQDYEKSLAYSHIYTPMHLANAYIQAGRWADAAAMADKSVEAVAAKEKKAPWDYRAY
FT                   LIRANCCFRARNYQECVDALRCALEIAPFVDPEILLLLGKAFRLKGCEEEALNYFKRVI
FT                   TTCGDLIEKPNQMKPAYTVYNIRGLVWLELEQYQEAINDFSRTVELAPEYYPHGHTHYK
FT                   SEGLKNLGLAYLEEGNRQKAGECFQKALAMVEEQGLELAGREINEIDEIKAWI"
     atgtgtatac caataagtgt attgacccgg gagtttgagg gggagactct ctataatcaa        60
     ggtctttcct atttcaaaaa ggggagtcca tttagccagg aagggataat agctttaaat       120
     gaggccaagg ccattttcaa cagggctatt gatttagagc ctgaactggc ggatgtctat       180
     tacatgagag gagttaccac gctgcagttt gttcacttct acaaccgccc gtttaataaa       240
     gaacaagaag gaatgtttga agaagcgcta aaagattttg ataaggcact gcagattaat       300
     gaagattatt ccattgccta tgcggggttt ggcaatgcct atgatcgcta cggaagcttt       360
     gatgaagcga ttgggtggta caataaagca cttgagcggg aggctgagat caaaagcaaa       420
     tggggtgaga gttctctgtc tgaaatctat ttcagcaggg gaagggctta tcatcgaacg       480
     cttaagcatt gctgcattca ggattatgag aagtcattgg cttattctca tatttacact       540
     ccgatgcatt tggcaaatgc ctatattcag gctgggagat gggccgacgc tgctgctatg       600
     gccgataagt cagtggaagc ggttgcggct aaagagaaaa aagcgccatg ggactaccgg       660
     gcatacctga tcagggcaaa ttgttgcttt agagctcgaa attatcagga gtgtgtggat       720
     gctttgagat gtgctttgga aattgctcct tttgttgatc cggaaatatt attgcttttg       780
     ggaaaagcgt tccggctcaa gggatgtgaa gaggaagcct taaattattt taagcgggtg       840
     ataacaactt gtggtgattt aattgaaaaa cccaaccaga tgaaaccggc ttacaccgtg       900
     tataatatta ggggcttggt ttggctggag ttggagcaat accaggaggc tattaatgat       960
     ttttcaagga ctgtggaatt agcacctgag tattatcctc acggccacac gcattataaa      1020
     tcggagggtt tgaagaattt gggtttggct tatttagaag aaggaaaccg gcaaaaagcc      1080
     ggggagtgct tccagaaagc acttgctatg gtggaagagc agggcttgga gttagccggc      1140
     agagaaatta atgagattga tgagataaag gcatggattt ga                         1182
//

If you have problems or comments...

PBIL Back to PBIL home page