(data stored in ACNUC7421 zone)

EMBL: CP001720.PE444

CP001720.PE444       Location/Qualifiers
FT   CDS_pept        complement(493821..494351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0482"
FT                   /product="flavodoxin/nitric oxide synthase"
FT                   /note="PFAM: flavodoxin/nitric oxide synthase; KEGG:
FT                   sat:SYN_00084 multimeric flavodoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61409"
FT                   /db_xref="GOA:C8W557"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C8W557"
FT                   /inference="protein motif:PFAM:PF00258"
FT                   /protein_id="ACV61409.1"
FT                   /translation="MLGICKERSELVKAMKISILYFSQTGNTQRMADIVKTGMETVPNV
FT                   EVRMFPLDAVDDDFLNESKAVIFGTPTYFANTCWQLKKWFDESHNYNLGGKLGAVFATA
FT                   NGLQGGFHTALSTVIDHLITKGMLVYSSGTGCGRPYIHLGAVAVKGHYEQGESLCYIFG
FT                   QRIAQKASELFGE"
     ttgttgggaa tatgtaaaga aaggagtgaa ttagtaaagg caatgaaaat ttcaattttg        60
     tatttcagtc aaacaggtaa tactcagaga atggcggata ttgttaaaac gggcatggaa       120
     actgtaccta acgtagaggt gaggatgttt cctcttgatg ctgttgacga cgatttctta       180
     aatgagagca aggccgtaat tttcggtaca ccaacctatt ttgccaatac ttgctggcag       240
     ttaaaaaaat ggtttgatga atcccataat tataatttag gaggtaagct gggtgctgtt       300
     tttgccacgg caaacggtct gcaaggaggt ttccacacag ccctctccac tgttatcgac       360
     catcttatca ccaaaggaat gctggtttat tccagcggca ccggttgtgg gcgcccgtac       420
     attcatttgg gggcggtggc ggtaaaggga cactatgagc aaggtgaaag cctgtgttat       480
     atttttggac agcgcatcgc ccaaaaagcg tctgaattat ttggagaata a                531
//

If you have problems or comments...

PBIL Back to PBIL home page