(data stored in ACNUC7421 zone)

EMBL: CP001720.PE449

CP001720.PE449       Location/Qualifiers
FT   CDS_pept        499724..500431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0488"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: bha:BH1808 two-component response
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61414"
FT                   /db_xref="GOA:C8W5V9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5V9"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACV61414.1"
FT                   /translation="MMLLATNILIADDEQAIADLVAVYLENENYHVFKFYNGKDTLNCV
FT                   ENERLDLAILDVMLPDMDGFSICQQIREKHNFPVIMLTAKEEEIDKITGLTLGADDYIT
FT                   KPFRPLELIARVKAQLRRFTKYNSAEPNQEEHLIAFSGLVLDKKTHECTLNEKRLSLTP
FT                   TEFSILWVLCSNRGRVVSSEELFHEVWGDKYFTNSNNTVMVHIRHLREKMHDSAEHPKY
FT                   IKTVWGVGYKIEK"
     atgatgcttt tggctacaaa tattttgatc gctgatgatg aacaagcaat tgccgatttg        60
     gtagcagttt atctggaaaa tgagaattat catgtcttta aattttataa cggtaaggat       120
     actcttaact gcgttgaaaa tgaaagattg gatctcgcca ttttggatgt catgcttccg       180
     gatatggacg gcttttcgat ctgtcagcaa atccgggaaa agcataattt tccggttatt       240
     atgctgacag ccaaagaaga agaaatcgat aagattaccg ggctgacatt aggtgcggac       300
     gactatatca ctaaaccgtt ccgccctttg gaacttattg cccgtgtaaa ggcgcagctc       360
     cggagattta ccaaatataa ttctgcggag ccaaaccagg aagaacactt gattgccttt       420
     tccggcttgg tattggacaa gaagacccat gaatgtacgc tgaatgaaaa aaggctatct       480
     ctcactccta cagagttttc tattctttgg gtcctttgtt ccaatcgcgg acgggtggtc       540
     agttcggaag aattgttcca tgaggtatgg ggagataagt atttcactaa cagcaataat       600
     actgtaatgg ttcatatcag gcatttaagg gaaaaaatgc acgacagcgc ggaacatcct       660
     aaatatatca aaacggtatg gggagttggc tataaaattg aaaagtga                    708
//

If you have problems or comments...

PBIL Back to PBIL home page