(data stored in ACNUC7421 zone)

EMBL: CP001720.PE450

CP001720.PE450       Location/Qualifiers
FT   CDS_pept        500421..501581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0489"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; SMART: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; KEGG: bar:GBAA5105 sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61415"
FT                   /db_xref="GOA:C8W5W0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5W0"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACV61415.1"
FT                   /translation="MKSERDKRRNDYTKLKRKVFFRMLLIIFTTAATVIFLRFVIQKNF
FT                   SVGDSIVQFLKNTFHMRDRDALIMYRFAFFNNIEAITLIVILIFLVILLKFSLSWFTKY
FT                   FDEVSAGMDKLTEESDAGITLSPELDFMENKLNQIKNNLEKQKKAALDAEQRKNDLVVY
FT                   LAHDIKTPLTSVIGYLSLLDEAPDMPPEQKAKYVGITLEKAYRLEQLINEFFEITRFNL
FT                   QTIVLNREKINLLFMLQQMADEFYPILTPQEKRVSVNVPDGLILWGDADKLARVFNNIL
FT                   KNAIAYSYENSVIDISAKQQEKNIVITFNNQGNPIPREKLETIFEKFFRLDTSRSTNTG
FT                   GAGLGLAIAKEIVNAHGGNIFVQSNTEKTVFTVVFPQKQEKDKLSA"
     ttgaaaagtg agagagataa aagaaggaat gattatacaa aattaaaaag gaaagtattt        60
     tttcgaatgc tccttattat ttttaccaca gctgcaactg ttatcttcct gcgttttgta       120
     attcaaaaaa acttcagtgt tggagatagt attgtacaat ttttaaagaa tacgtttcat       180
     atgcgtgaca gagatgcttt gataatgtat cggtttgcat tttttaataa tatagaagct       240
     attacactta ttgtgattct catattctta gttattttgc ttaaattttc actttcttgg       300
     tttactaaat atttcgatga agtcagcgct ggaatggata aacttactga ggaatccgat       360
     gctggaatta cattatcacc ggaattggat tttatggaaa ataagcttaa tcagataaaa       420
     aacaacttgg aaaaacaaaa gaaagctgct cttgatgccg agcagcgcaa aaatgatttg       480
     gtagtttact tggctcatga tataaagaca cctctgacct ctgttatagg atacttaagt       540
     cttctggatg aagctcctga tatgcctcct gaacagaagg caaaatatgt cggtattacc       600
     ttggaaaaag cttatcgatt agagcagctt ataaatgagt tttttgagat cacaagattt       660
     aatcttcaaa ctattgtttt gaatagagaa aaaattaatt tactgtttat gctccagcag       720
     atggcagatg aattctatcc aatactgact ccacaggaaa agcgggtgtc cgtcaatgtg       780
     cctgatggcc tcattctgtg gggagatgct gacaaactgg ctcgtgtgtt taataacatt       840
     ctgaaaaatg cgatagctta tagctatgaa aacagcgtca ttgacatttc tgctaaacag       900
     caggagaaaa atattgttat aacttttaat aatcaaggta atcctatccc acgagaaaaa       960
     ctggaaacga tatttgagaa attttttcgg ctggacacat cccgttctac taatacaggc      1020
     ggtgccgggc ttggactggc tattgccaaa gaaatcgtaa acgcgcatgg aggcaatatt      1080
     ttcgtgcaaa gtaatacaga aaagacagtc tttactgtcg tgtttccaca aaagcaagaa      1140
     aaggacaagt tatctgctta a                                                1161
//

If you have problems or comments...

PBIL Back to PBIL home page