(data stored in ACNUC7421 zone)

EMBL: CP001720.PE453

CP001720.PE453       Location/Qualifiers
FT   CDS_pept        503978..504850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0492"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: avi:Avi_7347 ABC
FT                   transporter membrane spanning protein (sugar)"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61418"
FT                   /db_xref="GOA:C8W5W3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5W3"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACV61418.1"
FT                   /translation="MRTGKLKTNNGYLTWLFLWPSLLGFSLFYLLPFVTGFYYSLVDSP
FT                   INGTFVGLHNYGALLKNPSFLSALANTAKFTLICVPLNMILSLGVALLLNQKLPGRNLF
FT                   RTIMITPLVVPVASVVLVWQAFFDLNGVLNSLIHALGYPPVDWMKTNWSIMVVLVGYLW
FT                   KNTGYSVILFLAGLQNIPAEYCEVARIDGASRRQEFFRITLVYLTPTTFFVFVISIINS
FT                   FKVFRETYLISGEYPHNSIYMLQHYMNNMFMALDYQKLTSAAFIMAAFIAAVVLVLFIV
FT                   ERKISNMIN"
     atgagaactg gaaaattaaa aactaataac ggctatctga cctggctttt cctctggccc        60
     agcctgctgg gtttttctct tttttatttg cttccgtttg ttaccggctt ttactattcc       120
     ctggtggaca gtcccattaa cggtactttt gttggattac ataattacgg tgctttgtta       180
     aaaaacccga gctttttatc agctctggcg aatacagcca agtttacttt aatctgtgta       240
     cctcttaata tgattctctc cctgggagtg gccttgttat tgaaccaaaa attaccgggc       300
     cggaatctgt ttcgcaccat catgataact cctttggtgg tacccgtagc ctcggttgtt       360
     ttggtctggc aggctttctt tgatttaaac ggcgttttaa attccctgat ccatgctctg       420
     ggttacccgc ccgtggactg gatgaaaacc aactggtcca ttatggtggt cctggtgggt       480
     tatctatgga aaaacactgg ttacagcgta atcctgtttc tggccggatt gcaaaatata       540
     ccggctgaat actgcgaagt agccaggatc gacggggcca gccgccggca ggagtttttc       600
     cgaataaccc tggtttattt gactcccaca actttttttg tttttgttat ctcgattatc       660
     aattcattta aagtgtttcg ggagacgtat cttatctccg gagaatatcc ccataacagc       720
     atctatatgc tgcagcacta catgaacaat atgttcatgg ctctggatta ccaaaaattg       780
     acttccgcag ccttcattat ggctgccttt atcgcagccg tcgttttagt gctttttatc       840
     gtggagagaa agatcagcaa catgattaat taa                                    873
//

If you have problems or comments...

PBIL Back to PBIL home page