(data stored in ACNUC7421 zone)

EMBL: CP001720.PE455

CP001720.PE455       Location/Qualifiers
FT   CDS_pept        507070..508473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0495"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bsu:BSU33260 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61420"
FT                   /db_xref="GOA:C8W5W5"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5W5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61420.1"
FT                   /translation="MKPAQSAYPAYLILALGLLVLAWSTVLGSSLPVKLGDLGGLHKTN
FT                   KITATWLSNSHQPEEGSFSLQDMRQLTQYNLRDYDLAYAMEASTSAAYQKNQSPVQVLG
FT                   VNDRYDQFHQINLRSGCFLTFEQENQQVAVINEDLAQALFRNCNVVGLEIELYGRKLKI
FT                   VGVAGNDRSLIGTLTDKGYGTVYIPAKVLLELEADSRITLLEVETKDAGTTGRNTAVLE
FT                   TALASIGQDPANYKIIDYSVAVLLMEQENLLRNFVAATVAMVMLFDLLRRKIMDIYHFC
FT                   RLRLRDKYWSEMIKGDAVRLMLGMAEILALVAVILLLWKLIRFSLYIPPENIPNELIDV
FT                   SFWADLIKKGIQTRMQSAGYAAPLGEIQFNILNTIQNWNLFLNIFLGWPLFLLGLYQIK
FT                   LLKEKLLKVELFCVVFMLAALSLGTALLWIIKMPPVTETGEMLLVFSSIFLAVVKRTGD
FT                   TPAETWAFL"
     ttgaaaccgg cccaatcagc ctatccggcc tatcttattc tggccctggg cctattggtt        60
     ttagcctgga gcaccgtcct gggctcatcc ctgcccgtta aattggggga tcttggcggc       120
     ctgcacaaaa ccaacaaaat taccgccacc tggctgagca actctcatca gccggaagaa       180
     ggctcttttt ccctgcagga tatgaggcag cttacccaat acaacctccg ggactatgat       240
     ctggcttacg ccatggaggc ttcaacttct gccgcctatc aaaagaacca gagcccagtt       300
     caggtgctgg gggtgaatga caggtacgat caattccatc aaataaacct gcgatcaggc       360
     tgttttttaa ctttcgaaca ggaaaaccag caggttgccg taatcaatga agatctggcg       420
     caggctcttt ttcgaaactg caatgtggtg ggcctggaga tagaactata tggccggaaa       480
     ctcaaaatag ttggggtggc cgggaatgac cgttctctga tcggaacttt gacggacaag       540
     ggatacggca cagtgtacat accggcgaaa gtactgttgg aactggaagc ggattcccga       600
     ataaccttat tggaagtgga aaccaaggat gccggcacca cgggccgcaa taccgctgtt       660
     ttggaaacgg ccctggcttc catcggtcag gaccccgcca actacaaaat catcgattat       720
     agcgtggcgg ttctcttgat ggaacaagag aacctgctgc gcaatttcgt ggcggcgacg       780
     gtggccatgg tgatgctttt cgacttgcta aggcgaaaaa taatggatat ttatcatttc       840
     tgccgcctaa gactccggga taaatattgg tcggagatga tcaaggggga tgcagtcagg       900
     cttatgcttg gtatggcgga aatattagcg cttgttgcag tgatactgtt gctatggaaa       960
     ttaatcagat ttagcttata tattccgccg gaaaacatcc ccaatgaact gattgatgtt      1020
     tcattttggg ccgacctcat taaaaagggg attcaaacca ggatgcaaag cgccggatat      1080
     gcagcgccgt taggagaaat tcagtttaat atccttaata ccatccagaa ctggaacttg      1140
     tttttaaata tctttcttgg ttggccgctg ttcttgctgg gactttacca gatcaagctg      1200
     ttgaaagaaa aactgctcaa agttgaactg ttctgtgtcg ttttcatgct ggccgcctta      1260
     agtctgggca ccgccttgct gtggatcata aaaatgcctc ccgtcacaga gaccggggag      1320
     atgctgctgg tattcagctc tatattttta gccgtggtaa agaggacagg ggacacacct      1380
     gctgaaactt gggcttttct ttga                                             1404
//

If you have problems or comments...

PBIL Back to PBIL home page