(data stored in ACNUC7421 zone)

EMBL: CP001720.PE458

CP001720.PE458       Location/Qualifiers
FT   CDS_pept        complement(511714..512337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61423"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5W8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61423.1"
FT                   /translation="MTKKIFIMLALVILLTVITGCQNRHSEKEEAVTGDKFVLPPFTKI
FT                   TLYVDGKKMDLKKNDPKVKKLSGEIYKGVINITDAVGGNRTFRPVGFEGDPKVVTKEYL
FT                   KDTVLIFAEWDKRHNISSKQKEMTLGHQGWEGTPKDKDGNYIINTDGFLVEIYKPNLDS
FT                   HFGYKKWSDGIGVSLKKPEEPVYWAYVEYDSLNCEKLLNIIVND"
     atgactaaaa aaatttttat aatgttggct ttggttattc tattaactgt cattaccggg        60
     tgtcaaaatc gtcattcaga gaaggaagaa gcagtcaccg gtgataaatt cgttctaccg       120
     ccttttacaa aaataactct ttatgttgat ggcaagaaga tggatttaaa gaaaaacgac       180
     cccaaggtta aaaagctatc tggtgagatc tataaaggcg ttataaatat tactgatgct       240
     gtggggggga acaggacttt tcgcccagtt ggattcgaag gagatcccaa agtagtaact       300
     aaggaatatt taaaagatac agtgttgata tttgctgagt gggataaaag gcacaatatc       360
     agttcaaaac aaaaagaaat gacgttgggc caccaaggtt gggaaggcac cccaaaggat       420
     aaggacggca attatataat aaatacagac ggctttttag tagaaatata taagcctaat       480
     cttgattctc attttgggta taaaaaatgg tcggatggga ttggtgtttc ccttaaaaaa       540
     cccgaagagc cggtttattg ggcttatgtc gaatatgact cgttaaattg cgaaaaactg       600
     ctaaatataa ttgttaacga ttaa                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page