(data stored in ACNUC7421 zone)

EMBL: CP001720.PE461

CP001720.PE461       Location/Qualifiers
FT   CDS_pept        515194..515946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0503"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61426"
FT                   /db_xref="GOA:C8W5X1"
FT                   /db_xref="InterPro:IPR025377"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5X1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61426.1"
FT                   /translation="MGNHRPHEYTSVDELIKKALQQRAENDNDIDLDEAWESFNKKYYI
FT                   KKQKPFLKLAVACLICSILGASILIIPTEGGAFGSKLFNNIKLFLSGKVQSTEISFNSP
FT                   GKKENTENYLNPDVLRILQDIPYNILLPVEMMGFYKIKEVDTNNLGNSTEVTILLTRGT
FT                   SEPITITEINTTKGFRQGNSFDTEDATMKNINIKGQEATLIQYKNNIYCLSWIDNDIFI
FT                   SIEGNIPIDDILMLANSMKRLSTQPNKL"
     atgggtaacc ataggcccca tgaatatacc tctgttgatg aacttataaa aaaagcactt        60
     caacaacggg cagaaaatga taatgacatt gatttagatg aagcgtggga gagctttaat       120
     aaaaaatatt atataaaaaa acaaaaaccg tttttaaaat tagcagttgc ttgtttaatt       180
     tgttcaatat tgggagcatc aatacttatt attcctacag aaggaggggc tttcggcagt       240
     aagttattta ataatattaa attattctta agtggaaaag ttcaatctac agaaatatct       300
     tttaactcac ctggcaaaaa agaaaatacg gagaactacc tgaatccaga tgttcttcgt       360
     attttacaag atattcctta caatatatta ctacctgttg aaatgatggg tttttataag       420
     ataaaagaag tagatacaaa caatttgggc aattctacgg aagttaccat ccttctgaca       480
     aggggtacct cagaaccaat cactattact gaaatcaaca caactaaagg ttttcgccaa       540
     gggaactcct tcgataccga ggatgctaca atgaagaata ttaatattaa aggtcaagaa       600
     gctacattaa tccagtataa aaataatatt tattgtttat cttggataga taatgatata       660
     ttcatttcca tcgaaggaaa tatccccatt gatgacattt taatgctggc taactcaatg       720
     aaaagattat ctactcaacc caataagctg tag                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page