(data stored in ACNUC7421 zone)

EMBL: CP001720.PE463

CP001720.PE463       Location/Qualifiers
FT   CDS_pept        complement(516556..516831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0505"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61428"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5X3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61428.1"
FT                   /translation="MLKFSPPPEKFGVSDNQQEFDVDGFTHLLGVLLKRSIDAHDRLTI
FT                   HTVWRTYGTFSEELVRITLGQLLGGGHPTSDLSGYLDALRIAALSQ"
     ttgctaaagt tttcgccacc gccagagaag tttggagtat ctgataatca gcaggaattt        60
     gatgtagatg gttttacgca tcttttaggg gtgttgctca aaagatccat tgatgcccat       120
     gatcgcttaa ccattcacac tgtctggcga acttacggta cttttagtga ggagttagtt       180
     aggataacac tcggacagct tttgggtggg gggcacccta cttcagattt atccggttat       240
     cttgatgcct taagaatagc ggctctgtca caatag                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page