(data stored in ACNUC7421 zone)

EMBL: CP001720.PE464

CP001720.PE464       Location/Qualifiers
FT   CDS_pept        516954..517121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0506"
FT                   /product="substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="KEGG: pfo:Pfl01_1606 substrate-binding region of
FT                   ABC-type glycine betaine transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61429"
FT                   /db_xref="GOA:C8W5X4"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5X4"
FT                   /inference="similar to AA sequence:KEGG:Pfl01_1606"
FT                   /protein_id="ACV61429.1"
FT                   /translation="MMKKTEQAIKDYGLDFTLRDSSSAGMSATLANKIKNKEWVIVTWI
FT                   YRCDETAVPE"
     ttgatgaaga aaactgaaca agctattaag gattatggtc ttgattttac tcttcgtgat        60
     agcagtagtg caggtatgtc tgctactcta gccaataaaa ttaagaataa ggaatgggtt       120
     atagtaactt ggatataccg ttgcgatgaa accgcagttc cggaataa                    168
//

If you have problems or comments...

PBIL Back to PBIL home page