(data stored in ACNUC7421 zone)

EMBL: CP001720.PE468

CP001720.PE468       Location/Qualifiers
FT   CDS_pept        complement(523543..523866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0512"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61433"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5X8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACV61433.1"
FT                   /translation="MLRAIFLLVILSLIIMLIGCSNDVYIPPDPIVDVKTYGDITKTKQ
FT                   KKLKIIVKNVTDSDLINVELWVGRNNISTKNKDLSKKVKNIKPGGIIKYYANITAQLPH
FT                   YKI"
     atgctaagag caatatttct tttagtcatt ctatcgttaa ttattatgtt aatagggtgt        60
     tcaaatgatg tttatatccc acctgatcca attgttgatg tcaaaactta tggagatatc       120
     acaaaaacaa aacagaaaaa gcttaaaatt attgtgaaga atgtaacaga cagtgattta       180
     ataaatgttg aactttgggt aggaagaaat aatatctcga caaaaaataa ggacttgagt       240
     aaaaaagtaa aaaacattaa accaggtggt attattaagt attatgccaa cattacagcc       300
     caacttccgc attataaaat ttaa                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page