(data stored in ACNUC7421 zone)

EMBL: CP001720.PE472

CP001720.PE472       Location/Qualifiers
FT   CDS_pept        527090..527989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0517"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system; KEGG: bsu:BSU03000 glycine
FT                   betaine ABC transporter (glycine betaine-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61437"
FT                   /db_xref="GOA:C8W5Y2"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5Y2"
FT                   /inference="protein motif:PFAM:PF04069"
FT                   /protein_id="ACV61437.1"
FT                   /translation="MRKIFKLLGIVGMLIALSTLLFGCGSSDSKDGQRNVSVKEKFNGE
FT                   IIGIEPGAGLMKKTEQAIKDYGLDFTLRDSSSAGMSATLANKIKNKEWVIVTGWTPHWK
FT                   WAAYDLKYLEDPKKVFGEEEHISTIARKGLAEDKPEAYKILDNFHWTPDDMQTVMLDVH
FT                   EGMSPDDAAKKWIAAHRDKVVEWTKDVDKSAAAGKTVKLGYVEWDSEIASTHVVKNVMQ
FT                   DLGFKAEATPVDNAIMWQGVSQGSFDAMVSAWLPGTHGDLYDKVKDTIDNLGPNLEGAK
FT                   IGLVVPDYVTINSIEELK"
     gtgcgaaaga tttttaagtt attaggtatt gttggtatgc tgattgcgtt aagtacatta        60
     ctctttggtt gcggcagtag tgactccaaa gatggtcaaa gaaatgtcag tgttaaagaa       120
     aaatttaatg gtgagattat tggtatcgag cctggtgccg gtttgatgaa gaaaactgaa       180
     caagctatta aggattatgg tcttgatttt actcttcgtg atagcagtag tgcaggtatg       240
     tctgctactc tagccaataa aattaagaat aaggaatggg ttatagtaac tggttggaca       300
     ccacactgga aatgggcagc ttatgattta aaatatcttg aagatcctaa aaaagttttt       360
     ggtgaagagg aacatatttc gactattgca cgtaaaggat tagcagaaga taagccggaa       420
     gcttataaaa tattggacaa ttttcactgg accccagatg atatgcagac tgttatgtta       480
     gatgttcatg agggtatgag tccggacgat gctgctaaga agtggattgc tgcgcaccgg       540
     gataaagttg ttgaatggac taaagatgta gataagtctg ctgctgcagg aaaaacagtt       600
     aagttaggtt atgttgagtg ggattctgaa attgccagta cacatgttgt taaaaatgta       660
     atgcaggact taggattcaa agctgaagct actccggtag ataatgcaat aatgtggcaa       720
     ggcgtatcac agggtagttt tgatgctatg gtatcagcat ggttaccagg tactcatgga       780
     gatctctatg ataaagtaaa ggatacaatt gacaaccttg gtccaaactt ggaaggagca       840
     aaaattggtc ttgtagttcc agactatgtg actattaact caatagaaga attaaaataa       900
//

If you have problems or comments...

PBIL Back to PBIL home page