(data stored in ACNUC7421 zone)

EMBL: CP001720.PE476

CP001720.PE476       Location/Qualifiers
FT   CDS_pept        531195..532379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0521"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   tdn:Suden_0535 secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61441"
FT                   /db_xref="GOA:C8W5Y6"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:C8W5Y6"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ACV61441.1"
FT                   /translation="MKKKLFIVLTILLILSGAITTVLHKEKQVAALSKPETAPYVFNGV
FT                   KAYKGSMTNYLSFQGEFQSDNEAQVKTKLTGNILSILEEGTTFKKGDVLVKLDDREIAD
FT                   GINVLEFNKAALINEMEGLQTIVSAQKIQMENALKNYERNKTLFQSGALSGQALDNAQN
FT                   LYQQAQSSYQDINTKLNVYQQKINSLNSQISQQKNLLSYTTILAPFDGVVAKKLLNTGE
FT                   LAGSTSPILQISGLGGYKVMVKVPVQVAAQINLQDDTLLTYGEQVVRAQIDKVLPAGEN
FT                   NLSVIELRLPNNTFQVPVHTFLQVQIPTGAQQNGIIIPVEAKFKNADNNTFAVKEVNGL
FT                   AVIIPVKVLVENNQNACVEGNIQSGDTLVIGYESKLLNLPANTRIKVVLKNDNK"
     atgaaaaaaa agctgttcat agtattaacc atactcttaa tcttatcagg ggcaataacg        60
     acagttctgc ataaagaaaa acaagttgcc gcattatcaa aaccggaaac tgctccctat       120
     gtttttaacg gtgtaaaagc ctataaaggc agtatgacca attacctatc atttcaggga       180
     gagtttcagt ccgacaatga ggcgcaagtt aaaacaaagc taaccggtaa tattctgtct       240
     atacttgagg aaggtacaac atttaaaaaa ggagacgtcc tggtaaaact ggatgatcgg       300
     gaaattgctg acggtataaa tgtgcttgaa ttcaataaag cagccctaat caatgaaatg       360
     gaaggactgc aaactatagt gagcgcccaa aaaatacaaa tggaaaatgc tctaaaaaac       420
     tatgagcgca acaaaactct gtttcagagt ggcgcattgt ctggacaagc tctggacaat       480
     gcccaaaatt tataccagca ggcacagtca agctatcagg atatcaacac aaaactaaat       540
     gtctaccagc aaaagatcaa ttccctgaac agccagatca gccagcaaaa aaatttatta       600
     agttatacca ctatattggc tccctttgat ggggtagtag ccaaaaaatt attgaatacc       660
     ggagagcttg ccggctcaac ctctcccata ctacaaataa gcgggttggg tggatacaaa       720
     gtgatggtta aagtgccggt gcaggtggct gctcaaataa accttcagga tgatactctg       780
     cttacctacg gggaacaagt cgtcagagca cagatagaca aggttcttcc ggcaggagaa       840
     aataacctgt ccgttattga gttaagactg ccgaacaata cttttcaagt acctgtgcac       900
     acttttttac aggtacaaat accaaccggt gcccaacaaa acggtataat tataccggtg       960
     gaggccaaat ttaaaaatgc tgacaataac acttttgcag tcaaagaagt aaacgggtta      1020
     gctgtgataa ttccggtcaa agtactggta gaaaataatc aaaatgcttg tgtagagggg      1080
     aatatacagt caggggacac tttagtcatc ggctatgaaa gcaagctgct gaaccttccc      1140
     gcgaatacca ggataaaggt cgtgttgaaa aatgataata agtaa                      1185
//

If you have problems or comments...

PBIL Back to PBIL home page