(data stored in ACNUC7421 zone)

EMBL: CP001720.PE478

CP001720.PE478       Location/Qualifiers
FT   CDS_pept        complement(536032..537792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0523"
FT                   /product="Transposase-like protein"
FT                   /note="KEGG: hha:Hhal_0784 transposase, IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61443"
FT                   /db_xref="GOA:C8VWQ4"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:C8VWQ4"
FT                   /inference="protein motif:COG:COG5421"
FT                   /protein_id="ACV61443.1"
FT                   /translation="MFLKKSVKTVKGKKYSHYSIVESFRDNGKVKHRLIFAIGPLDDEA
FT                   ADRLRLTLNAHSNQDLVVAKSDDIVVTKHGAYLDVAVLVHIWQQWQFHEFFQDDRWVTG
FT                   MVINRCIDPVAKCNVQEWMTKTVLPAYIDTDPLSMNAFDIFRELDRLCQRETELQSYMF
FT                   RKIQEKRPNSLDVFFYDITSTYVTGSRCVLTKFGYSRDHRPDCEQIVIALMITPDGYPF
FT                   YWKLLEGNTQDVSTVCDLIQNVKTCFPIQHCTMVFDRGMVSADNLKTLEKTNWDYVSAM
FT                   DRDEINVLSFFETALPTPPMPEDWEQVLAMQEFQPIDDDILYYREFEDDNRRYIITFDV
FT                   ARFLDEHQIQRNKVEQINRWLIKKNGDLKQAKKSRNRDTLEREISKISKRFHVHKYLSV
FT                   QITPCSRTVTTKTGKSRTVESFQLSDTIDNTALQKEQRLYGITCFISNITQERISAQEI
FT                   VQWYRRKNKIEEAFREIKSHLELRPIYLTREKRVRAHVAVCMLAYFLRNDIELQLKEHG
FT                   ISNSTETVLALLAECKANRWVFDKSEAKTHLNITKVSEKQQQILKALGCESIVDVKHVK
FT                   NILQKAENWL"
     atgtttctca agaaatccgt taagacagtc aaagggaaaa aatactccca ttatagtata        60
     gtcgaatcat ttagagacaa cggtaaagtt aaacaccgct taatttttgc aattggccct       120
     cttgatgatg aagcagccga tcggttacgc ttaacgctta atgcccactc taaccaagat       180
     cttgttgtgg ccaaatctga tgatattgtt gtcacaaagc atggagcata tttagatgta       240
     gctgttctgg ttcatatctg gcaacaatgg cagtttcacg agttctttca ggatgaccgc       300
     tgggttacag gtatggtaat taaccgttgt attgacccgg ttgcgaaatg caatgtgcag       360
     gagtggatga ccaaaacagt actgcctgcc tatatagata cagatccatt gtcaatgaat       420
     gcatttgata tctttcgaga actagaccga ctatgccagc gagaaaccga gctacagtca       480
     tatatgtttc gtaaaattca agaaaagcga ccaaatagcc tggatgtgtt tttttatgat       540
     attacctcta catatgtaac aggaagtcgc tgcgtactta ctaagtttgg ctactcgcgg       600
     gatcaccgtc ccgattgcga acaaattgtt attgctttga tgattacccc ggatggttac       660
     cctttttatt ggaagttgct ggagggtaat actcaggatg tttccacagt ttgcgactta       720
     atccaaaacg tcaagacttg ttttcccata caacactgca ccatggtttt tgaccgaggt       780
     atggtatctg ctgataacct taaaacatta gagaaaacaa attgggatta tgtttcggca       840
     atggacaggg acgagattaa cgtattatca tttttcgaaa cagcattgcc aacccctcct       900
     atgccggagg actgggaaca agtcttggcg atgcaggaat ttcaaccaat agatgatgac       960
     atattgtatt accgagaatt tgaagatgat aatcggcgat acattataac ttttgacgtg      1020
     gcacgttttc ttgatgagca ccaaatacaa agaaataagg tagaacaaat taataggtgg      1080
     ctaatcaaaa aaaatgggga tttgaaacaa gccaaaaaat caagaaatcg tgacactctt      1140
     gagcgagaaa tcagcaaaat ctcgaaacgg tttcatgttc ataaatattt gtccgttcag      1200
     attacgccct gttctcgtac cgttacaact aaaactggta aatctcgtac tgttgaatca      1260
     tttcagcttt cagatactat tgacaacact gctttgcaga aagaacaacg tttgtatgga      1320
     atcacatgtt ttatctccaa tattacccaa gagcgtatat ctgctcagga aatagtacag      1380
     tggtatcgac ggaaaaataa aattgaagaa gcctttaggg agataaaatc acatcttgaa      1440
     ttacgtccaa tttatttaac cagggagaaa agagtaaggg cccatgttgc tgtttgcatg      1500
     ctagcctatt ttctgagaaa tgatattgag ctccaactta aggagcacgg aatttccaat      1560
     tcaactgaga cggttttagc cttattagct gagtgcaagg ctaatcgctg ggtctttgat      1620
     aaatcggagg caaagacaca cttaaatatc acaaaggtct ccgaaaagca acaacaaata      1680
     ttaaaagcgc ttggatgtga atcaattgtg gacgtaaagc atgttaaaaa cattttacaa      1740
     aaggccgaaa attggctgta g                                                1761
//

If you have problems or comments...

PBIL Back to PBIL home page