(data stored in ACNUC7421 zone)

EMBL: CP001720.PE48

CP001720.PE48        Location/Qualifiers
FT   CDS_pept        complement(54120..56735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dtox_0050"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: dvu:DVUA0087 sensory box histidine kinase;
FT                   TIGRFAM: PAS sensor protein; PFAM: ATP-binding region
FT                   ATPase domain protein; PAS fold-4 domain protein; PAS fold
FT                   domain protein; histidine kinase A domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; PAC repeat-containing protein; PAS
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dtox_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACV61013"
FT                   /db_xref="GOA:C8VVE3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C8VVE3"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ACV61013.1"
FT                   /translation="MSRFKFPLIYMIVFLLLIAGIMLTDLLNYHSQQNNIMINSYYPII
FT                   ILLIVTFISLIIYLVFPEQIYKFYPLSMKNVLLKYANDILFLFDCDFNFIEINDKAIKT
FT                   YGYSHKEFLKMKFHDLIDHNKCPQFNEICKKIDSYHGYIYETVHQRKDGSTFPVEISSR
FT                   PIIAGRKKYYHSIIRDITVRKQVEDQLRQANLDLNTKIKELLHSEEKFNKAFHASPVIM
FT                   SISTLKDGRYMEINDSFVRLHGYSREEIIGRTALEIGAWNDPCDRDIVAQLLNEQGYVK
FT                   NLEVNYFTKARELHTGLLSIELINFGGEQCLIAIMHDITDLKRTEKQLQQSKQELTTLL
FT                   ENIPDIISRFDRNLRYLYVNPAVTQATGLHQNCFIGKTNRDLDMPEEQVHIWNRALEKV
FT                   FMTGKNHIIEFYYQLADKQKHFESRLIPENSPQGEVESVLVICRNITMRKEMEHRLTTY
FT                   QEQLENMVYKRTLALKKSNEQLKQEIIERLQAETALQQSERKYRALFNNTNDAILLHGI
FT                   SGNNSFESIIEVNDAVCRRLGYTREELTQLSLADIYAPESRRLLPNILNIILNRKHLTF
FT                   EVIHITKTGQKIPVEAASHLFTLNGKKVILSVIRDITERKRAEAELQEARQQAERLQTM
FT                   ASLATMTAGIAHEINQPLNSLKIMVDGLLFWHDRNGTLDENELIDGLKNISAQADRISL
FT                   IIRRMKALVRHESPPNLYPCNLNSAVEKAIVTMHAQLLASNIKLRNILQNPLPPLSGEN
FT                   FGLEEVIVILLVNAIQALNNSRQIDKEILITTRSERYIILEISDNGSGVPTDLQEKIFE
FT                   PFFTTKEVGQGMGLGLSIAHTIITSFHGQISLRTNEKGGTTFQLDFPVYNNDLIEEVGL
FT                   "
     atgtcaagat tcaaattccc tctaatttac atgattgttt ttttattact catcgcgggg        60
     atcatgctaa ccgatttatt aaattatcac agtcaacaaa ataatattat gattaactcg       120
     tattacccga tcattattct cttaatagtt acttttatca gcctaataat ttacctggtc       180
     tttccagagc aaatttataa gttttaccca ctgtcaatga agaatgtatt gttaaaatat       240
     gctaatgata tattgttttt gtttgactgt gattttaatt ttatcgaaat caatgataaa       300
     gccatcaaaa catatggcta ttcccacaaa gaatttctta agatgaaatt tcatgattta       360
     attgatcata ataaatgtcc tcaatttaat gaaatatgca aaaagataga ttcttatcac       420
     ggttatattt atgaaacagt tcatcaacga aaagatggct ccacatttcc tgtagaaatt       480
     agttcccgcc cgattattgc cggtaggaaa aaatactatc attccattat tcgcgatata       540
     actgtgcgca aacaggtaga agatcaatta cgtcaggcta atttggattt aaatactaaa       600
     attaaagaac tcctccattc ggaagagaaa tttaataaag ccttccacgc cagcccggtc       660
     attatgtcca tttctacctt aaaggacggt cgctacatgg aaattaatga ttctttcgtt       720
     agattgcatg gttacagccg ggaagaaatt atcggccgca ccgcgcttga aattggtgcc       780
     tggaatgacc cctgcgatcg tgatatagta gcgcagctgt taaatgaaca aggttatgta       840
     aaaaacttgg aggttaatta ctttactaaa gcacgtgaac tgcatactgg cttgctctcc       900
     atagagctta tcaattttgg cggtgaacaa tgcctgattg ccatcatgca tgatataact       960
     gatctcaaac ggacagaaaa acagctgcaa caaagtaaac aggaattaac gacgctctta      1020
     gaaaatattc cggatataat ttcccgcttc gatcgcaacc tgagatacct ttatgtaaat      1080
     ccggccgtaa cgcaggcaac cggacttcat caaaactgct ttatcggaaa aaccaatcgt      1140
     gatctggata tgccggaaga acaggtacat atatggaaca gagcattgga aaaggtattt      1200
     atgaccggca aaaaccacat tatagaattt tactaccagt tagccgataa acaaaaacat      1260
     tttgaatcac gcctgatacc tgaaaattca ccgcagggcg aagtggaatc agtactggta      1320
     atttgccgga atatcaccat gcgcaaggaa atggaacaca ggttgaccac ataccaggag      1380
     caactggaaa atatggttta taagcgcacc ttggcactaa aaaagagcaa tgagcagctt      1440
     aagcaggaaa taattgaacg tttgcaagct gagacggccc tccagcaaag cgaaagaaaa      1500
     tacagggcac tgtttaacaa tacaaatgat gccatattat tacatgggat ttcaggcaat      1560
     aactctttcg aaagcattat agaagttaat gacgctgtct gccgccgcct gggctatacc      1620
     cgtgaagaac tgacgcaatt gtcactggct gatatttatg ctccggaaag ccgtcgatta      1680
     ctgccaaata ttctaaatat tattttaaac cggaaacact tgacctttga agtaatacac      1740
     attactaaaa ccggtcaaaa aataccggtt gaagcggcat ctcatttatt taccttaaac      1800
     ggcaaaaaag taatcctgtc tgtaatccga gatattacag agcgcaagcg tgcggaagct      1860
     gaattacaag aagcccgtca gcaggcggaa aggctgcaaa ccatggcttc ccttgccact      1920
     atgacagcag gcattgccca tgaaatcaac caaccactga actccctaaa aattatggtg      1980
     gacgggttgc tgttttggca tgatcgaaac ggaactcttg acgagaatga actaattgat      2040
     ggactgaaaa acatctctgc tcaagcagat cgcatcagct tgattattag acgtatgaag      2100
     gctctggttc gacatgaatc acccccaaat ctctacccct gcaatctcaa cagcgctgta      2160
     gaaaaagcta tagttacaat gcatgctcaa ttgctggcat ccaatattaa attgcgaaat      2220
     atattacaaa acccattgcc gccgctttcc ggagaaaatt ttggactgga agaggtgatt      2280
     gtcatcctgc tggttaacgc catacaggca cttaataaca gtagacaaat agataaagaa      2340
     atactcatta ccacacgttc tgaaagatat attattctgg aaataagtga taatggcagc      2400
     ggagtgccaa cagatttaca agagaaaatt ttcgaacctt tttttactac caaggaagtg      2460
     ggacagggta tgggtttggg actttctatt gcccatacca taataacatc tttccatggg      2520
     cagatttcac tcaggacaaa tgaaaaagga ggaactacct ttcaactgga ttttcctgtt      2580
     tacaataatg atttaataga ggaggttggg ctatga                                2616
//

If you have problems or comments...

PBIL Back to PBIL home page